tg0664

Coordinates:634277-634588

>tg0664 hypothetical protein TGAM_0664
MGEGAYQTVPAELDALLGAHSEDDGETKSKTSNSSGDSRPGKLPKAKLNKKLIAAIVRRLRILYLDAPKKEDRILINEIL
DDLEQLMILNGIGLELLGGKPKEE

>tg0664 hypothetical protein TGAM_0664
atgggggaaggtgcatatcaaaccgtgccggcagagctcgatgcccttctcggtgcacattccgaggacgatggagaaac
aaagtctaaaacgtcaaattcatcgggagacagcaggcccggaaagcttcccaaagcaaaattgaacaagaaactaattg
ctgccatagtccgccgccttcgcattctttacctcgacgctcctaagaaagaagacagaatccttatcaatgaaatcttg
gacgatttagagcagttaatgatactaaacgggattggccttgaactcttaggaggaaagcccaaagaagaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 633777 - 635088 (Additional range around tg0664 is :500nt.)

>Thermococcus gammatolerans EJ3 AGCCGGGTGATCGGTTATCCAATCGGACTCCGCGAGGACCTCAACGACTACGTGATCCTCTATCAGGTCAGACCCCCAAG CTGGCTTGACAGTCTAGTTCACAGCCTCTTAAGAGTAGTGGGTAAAAGCCCACCGACAGCCTTAATCCGCGTTCCCAAGA AAATCGCCTACTTCGGCGACGAGACAATAACAATCCTCGCCAGCGCCTTCATCATGAACGAGCACTATGAATACGAGGCC GTTCCTCTGTCCCTGGACGAGACTGACGCGAAGCTTTACCTAGCTTTGAAGAAGGAGAACGACATGCTTTGGGACCTGAT AAGCATCATCCGCTATCGCGTGCCCGAAGTCGTCGAGGACGCTATGAAAATGAACCCAAGGATAAAGACTTACATGAGCA CCAAACAGCAAAACCCGGACGAGGGGACAAAGGAAGAGAAGTTTGGTGGCGTTGAGGTGGCCTTCGAGGACAACCCGTTC AGACGCTGGAGGTTGCCGTA atgggggaaggtgcatatcaaaccgtgccggcagagctcgatgcccttctcggtgcaca ttccgaggacgatggagaaacaaagtctaaaacgtcaaattcatcgggagacagcaggcccggaaagcttcccaaagcaa aattgaacaagaaactaattgctgccatagtccgccgccttcgcattctttacctcgacgctcctaagaaagaagacaga atccttatcaatgaaatcttggacgatttagagcagttaatgatactaaacgggattggccttgaactcttaggaggaaa gcccaaagaagaa TAAAACCTCTGCATCATCAACGACCTGTCTTGAGTTTTCCCTTATAAATTCATAATTCTCTCTTCC AGCTCCTTCTCATTTTGAAGAAGTTCTTCTTTCATTCTTTCCACTTTCTCTGACAGGGATATAGTCATTTTCTTTAATTC TTCCATTTCCCTGCTTCTTTCTATAAGTTTGTTATAAATGGGGATATTATTGTTCTGAAGGTATTTTAGGAACACTTCTT TTGTACTTTCCCACAGCTCAAGCCGGTACCGTTTATCTTTTTTCGGATCTAGCCCCAATAATCCAAACCTTGGTGGTTCA ATTTTGCTTATATCCTCCTTAAATTGATATACAAGTTCTGGTATTATAATCTTAGGCGCGACTTCCGGTTTATTTGATTT TTCGGCTATTTCTTTGGAGACTTGTGATAGTCGAGCATTAAGCGCGCTATCCTCTTCTAGCTTTTCAATAATCTCCTTAG TATTAGCGTTTATTTTCCTGATTAATTCATTGT