tg0668

Coordinates:637432-638373

>tg0668 hypothetical protein TGAM_0668
MVRAMTQKGRKRRNRSGPGRPPVFDEPVYTAFWMEKEDKERLYEQKGTLPVGVYVGMLLRSKSAEKAILMRQLAEKDRLL
EEKDRCIEELEKLVERLQDELEKWRFRAEACEKNKPKLSSKWSKILLAIPKAVEEGLTWNDLMRDLGILDPQEQVAVMQR
FFITIDENGKIPEVIKPLQGIKELEGIVLYRENGVNVRFAKIVREDTLKAAKSLRVEAPKPAKKGRPAVKVSRAEIEKSL
KAWLKQYEQWASNWRTKEKAEQFLKSVGNNGLRRLVREYGFDVVAEVVGSNADYRALFGPFLLKLQEKKVEVKA

>tg0668 hypothetical protein TGAM_0668
ttggtgagagcgatgacacagaagggcagaaaacgcagaaatcgcagtgggcctggaaggccaccagtatttgatgagcc
tgtttacacagcattctggatggaaaaagaggataaagagagactttacgagcagaagggcacacttcccgtaggcgtct
atgttggcatgctcctgaggtctaaaagtgccgaaaaggctattctaatgagacagcttgcggagaaagacaggcttctc
gaagaaaaagaccgctgtatcgaagagcttgaaaagctcgtcgagcgccttcaggatgagcttgagaagtggcgcttccg
tgccgaggcttgcgaaaagaacaagcccaaactctcttccaagtggtctaagattctcctcgccattcccaaagcagttg
aggagggcctcacgtggaacgacctcatgcgggacctcggaatcctcgacccccaagaacaggtcgcagtcatgcagcgc
ttcttcatcacgattgacgagaacggcaagattcccgaagtcatcaagcctctgcaaggcatcaaggagcttgagggcat
tgtcctctaccgcgagaacggcgtgaacgtccgctttgcgaaaatcgtccgtgaggacacgctcaaggcggccaagagtt
tgagggtcgaagctccaaaacctgccaagaaaggtcggcctgccgtgaaggtttcgagggctgagattgagaagagcctc
aaggcttggctaaagcagtatgagcagtgggcgtccaactggcggacgaaggagaaggcagagcagttcttgaagagtgt
tggcaacaatgggcttcgtcggcttgtgcgggagtatggtttcgatgttgtggcggaggttgtcggttctaacgcggatt
atcgggccctgttcggcccgtttctcttgaagcttcaggaaaagaaggtggaggtgaaagca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 636932 - 638873 (Additional range around tg0668 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGAGCGAAAGTTGCTTTCTTGATTATTCTCTATATTTCAGGTTTAAATTTATTTAATTCTCGTAGAAAGAAGGAAAGAA AAAGTAGCTTTTCGTCTCTTCTCGATTGAGAAGTCTGCAATTTGGCTAATTTAATTTTATAAAATTAAACTTGTGTGCAT TTCTTTGCAGTCGAGTAATGGGCATGGTTTCTGATCCTCAAACCTTCAAATGCACATGTTTTGACAGAAAAGCTTTTAAG GATACGTATCATACGTATATACGAATAAAACGTATAAGGTGATGACCGTGGCAGAACCCAAAGTCAAGTGGGTTGTGGAC GTGCCTTACAGCCTCTTTGAAAAGCTGGAGGCCATGAGGGGAGATCTCCCACGCTGGAAGTTTTTGGACCTTATGGCCAA GGACGACAAGCTTGAGGAACTCGTTCGCTTGAAGGTGGAGAACGAAAAGCTAAGGAAAGAGATTGAGCGCCTGCAAGCTT TGGTCAAAAATTGAGCTTTC ttggtgagagcgatgacacagaagggcagaaaacgcagaaatcgcagtgggcctggaag gccaccagtatttgatgagcctgtttacacagcattctggatggaaaaagaggataaagagagactttacgagcagaagg gcacacttcccgtaggcgtctatgttggcatgctcctgaggtctaaaagtgccgaaaaggctattctaatgagacagctt gcggagaaagacaggcttctcgaagaaaaagaccgctgtatcgaagagcttgaaaagctcgtcgagcgccttcaggatga gcttgagaagtggcgcttccgtgccgaggcttgcgaaaagaacaagcccaaactctcttccaagtggtctaagattctcc tcgccattcccaaagcagttgaggagggcctcacgtggaacgacctcatgcgggacctcggaatcctcgacccccaagaa caggtcgcagtcatgcagcgcttcttcatcacgattgacgagaacggcaagattcccgaagtcatcaagcctctgcaagg catcaaggagcttgagggcattgtcctctaccgcgagaacggcgtgaacgtccgctttgcgaaaatcgtccgtgaggaca cgctcaaggcggccaagagtttgagggtcgaagctccaaaacctgccaagaaaggtcggcctgccgtgaaggtttcgagg gctgagattgagaagagcctcaaggcttggctaaagcagtatgagcagtgggcgtccaactggcggacgaaggagaaggc agagcagttcttgaagagtgttggcaacaatgggcttcgtcggcttgtgcgggagtatggtttcgatgttgtggcggagg ttgtcggttctaacgcggattatcgggccctgttcggcccgtttctcttgaagcttcaggaaaagaaggtggaggtgaaa gca TGAGTGAGGTTGCGGATTTCTGGAGTTGGGTTGCGCAGGAGAAGGCGAAGTTGGATGAAGTGCTACGTGATAGGGA GGAACCGCCCACCTTGATTGACTGGCTTGAGCGCGAAATCACAGAGGCTCGGGAGGCAGCGTTCTCTCTCAAGATTCGCG GGGAGAACGGCGCGGAGTACTGGACTGGCTACGCTGATGCCCTCGAGGACGTTCTGAAGGCCATACAGAGGAGGGAGGTG AGGGCATGAGGAAGAAGTCGATTCTCGAGATTTGGGAGGAGGTTAGAGACAGCTATGGGAAGGAAGATGAGTGGGCGGCG CGCGGAGTTTACCTCGACCCCGCCGAGAACGACCTCTATCGCGAAATCAAGCTCAGGGAATACTACAGAAGGAAGGAGGG TCGCTCATGACGTGGCTCGAAGCAAGAGCTCCAAACTTCTCAAAGTGGAAGCGCTTGGTTGACCTCAGCAGGGTTGCGGC TTTAGATGTCATTGAGAATGAGA