tg0671

Coordinates:639063-639452

>tg0671 hypothetical protein TGAM_0671
MTRFVSLSEELAVKLEYARAEWEAQKVQILIENDEVPEGHEVALELKDLVSYLESLEIPTRVVIDSEVYKVKLRKKVPYD
RYREILAGLNNLSHARWDKKARAILVDRTREMEEQLEVEEIVITPKEVRA

>tg0671 hypothetical protein TGAM_0671
atgactcgctttgtttctctttctgaagaactcgctgtcaagctcgagtatgctcgggccgagtgggaggctcagaaggt
gcaaatcctgatcgagaacgatgaggttccggaggggcacgaagttgcccttgagctaaaggacctcgtgagctacctcg
aaagcctggagatcccgaccagggtcgttatagactctgaagtctacaaggtgaagctcaggaagaaggtgccctacgac
cgttacagggaaattttggcgggcctgaacaatctctcacatgctaggtgggacaagaaggcgagagcgattctcgttga
caggacgagggagatggaagaacagcttgaggttgaggagatcgtcatcaccccgaaggaggtgcgggcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 638563 - 639952 (Additional range around tg0671 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGATGCCCTCGAGGACGTTCTGAAGGCCATACAGAGGAGGGAGGTGAGGGCATGAGGAAGAAGTCGATTCTCGAGATTT GGGAGGAGGTTAGAGACAGCTATGGGAAGGAAGATGAGTGGGCGGCGCGCGGAGTTTACCTCGACCCCGCCGAGAACGAC CTCTATCGCGAAATCAAGCTCAGGGAATACTACAGAAGGAAGGAGGGTCGCTCATGACGTGGCTCGAAGCAAGAGCTCCA AACTTCTCAAAGTGGAAGCGCTTGGTTGACCTCAGCAGGGTTGCGGCTTTAGATGTCATTGAGAATGAGAAAAACGCTGT CATTGGCCTTAGAAGCGCGAACGATGCCGAGCTGGCAAAGCTTGTCGTCGAGAAGGAAAAGCTACAAGAAACAATCGACG CTCTCACGCTTCTCATCGAGCAGTCAAAGCAGTTCAGCGACGCTAAGGTCTTCACGCTCGAAGAAGTCCTTCAGGCCAAC ACTCGCCAGGGGGTGTGGGC atgactcgctttgtttctctttctgaagaactcgctgtcaagctcgagtatgctcgggc cgagtgggaggctcagaaggtgcaaatcctgatcgagaacgatgaggttccggaggggcacgaagttgcccttgagctaa aggacctcgtgagctacctcgaaagcctggagatcccgaccagggtcgttatagactctgaagtctacaaggtgaagctc aggaagaaggtgccctacgaccgttacagggaaattttggcgggcctgaacaatctctcacatgctaggtgggacaagaa ggcgagagcgattctcgttgacaggacgagggagatggaagaacagcttgaggttgaggagatcgtcatcaccccgaagg aggtgcgggcc TGATGGCCTCCCGTACGGCTTTTGTCTATCAGGATGCCCTTAGCATTGACGATGCCTTTACTTACTTC AAGCGCCTCATGCGGGACGCTGAGAACCGCGTGGCCTTTTCGAGGGCCCTCCAGAAGGCCAGAAAGGGCCTGGACGTGCA CATGTACGTTACCGACATTGACAGCCTCATCGTGCAGTATCTCAGGAGAAACGGCGTTAGAGGCTTCCGTTTCACCGGTT TTGAACTCAAAAACATGAACCCGCGCTCGGCAATCGTGAACGGGAAGGTCAAGGTGAATGGGAAGCAGTACGAGGGGCAC AAGTGGTTTGCGGAGAAGGCAGGTATGGATTTCTACTATCTTGTTAACCTCGGCAGGGAGTTCTTGGTTTGGAATATCAG GAACACTTACGCAGACTTCAGGTGGTACGGTGAGGGGCACGCGCATGATTACTACGCTTTCGTGGATTTGGATGATGTGA TTCGTGTTCCAGCTCAGGAACTGCCGGAAAC