tg0675

Coordinates:641475-641936

>tg0675 hypothetical protein TGAM_0675
MKPKIALPENEFKLKGLYNFLELIFDDDEHRIGIAEALLERLRQKRETYSEDWLEVILEYLGEQDLLEQYHELLNKFDNG
EISKTKINKLIEKELRERGYPAAKLRNDWAIVKKTLIKLGIVSRTSNRLNLSWDFVERLNTLAKFYNLWRAGEI

>tg0675 hypothetical protein TGAM_0675
atgaagcccaaaatcgccctgccagaaaacgagtttaaactcaaaggcctctacaacttccttgagctaatctttgatga
cgatgagcatagaataggcatagccgaagccctcctcgagcggctgaggcagaagagggaaacctactctgaggactggc
ttgaagtcattcttgagtacctcggcgagcaggacttgcttgagcagtatcacgagctcctcaacaagttcgataacggg
gaaatcagtaagaccaagataaacaagctcattgagaaggagctccgcgagaggggttatccggccgcaaagctgaggaa
cgattgggcaatagtcaagaagacactcataaaacttgggattgtgtccagaacttccaacaggctgaatctgtcgtggg
atttcgtggagcggctgaatacactggccaaattctacaacttatggagggctggagaaata


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 640975 - 642436 (Additional range around tg0675 is :500nt.)

>Thermococcus gammatolerans EJ3 AATCTGGAAGGAGGGGAGAATATGACCGTTAACTTTCGTATGAATGTTAACGTGCTCACGGATTTTGTGAGTGGGGTTTT GGTTTCGCTGAGTGCTGGCTGGTCTCTAGCTCACATTTTTTGTGAATACGGGCCTTCATTTATGGGTGGGCAAGATACCA CATCAAACACCCTCACAAGCCTGACCACATTCACAAAAACCGTGAACGAGGTGGCGTGAACTATGAGAAGAGACTGGCTT GAATTTGTAACTATACTTGTGATAGTATTGTTCAGTACTTTCCTACTATCGCACACAGGTAATACACCAAACAAAGACAC TCCACAGATAAACATAATCAAAGAAGCTAACGTCTCCGCGGGAGGCCTAAGTACAGTTTTCTCATTCACATATAACGACT CCTACGGCATATATCACTGCATCTATTTTGACGGGGGTTATGATGGCGGGCTCTGGTGTGAACGACTCAAAAATTCAACG CCTACAGGAGGAGAGGATAA atgaagcccaaaatcgccctgccagaaaacgagtttaaactcaaaggcctctacaactt ccttgagctaatctttgatgacgatgagcatagaataggcatagccgaagccctcctcgagcggctgaggcagaagaggg aaacctactctgaggactggcttgaagtcattcttgagtacctcggcgagcaggacttgcttgagcagtatcacgagctc ctcaacaagttcgataacggggaaatcagtaagaccaagataaacaagctcattgagaaggagctccgcgagaggggtta tccggccgcaaagctgaggaacgattgggcaatagtcaagaagacactcataaaacttgggattgtgtccagaacttcca acaggctgaatctgtcgtgggatttcgtggagcggctgaatacactggccaaattctacaacttatggagggctggagaa ata TGATCAGACTCAAGATTTACAAAGAAGACGGAGTCTGGTGCGTGGAGGATTTAGCAGGTTATGAGGTTGGTTGTGG CAGGACGATCGCTGAGGCCTTCAAGGACTTTGGGGAGAACCTTGAGGCTGCGATTGAGGAGTATGTTGAAGATAACGACC TCGACAAGTTCCACATTTCTGCAATAGCCCTCCGCTATGCCTTACTCGATTGGCTGAGGTGATTCTCATGACCGTAGTCT TAATATTCACCTCCGGCCATTGTCCCACGGGTGGGCCAAAGTGGGCCATAGTGGGCCGTCATATGGCAGGGCTCTCAACA GAGATTTGGTCGAAAAGAAGCGAAAGACGCGCGTTCATTTGTACCTTGATGCAGAAGTGGTCGGCGGTCTCAAAGAAGAG GGCTTTAATCTCTCGGCCCTCGCAAATAAGCTTCTTAAAGAGCATTTAGAAAAGGTGAGGCGCATGGAAGTGATTATTTC GAGAATGGCGGGCCCGGCGGGAT