tg0677

Coordinates:642579-643244

>tg0677 CRISPR-associated protein, Cas4 family
MRADEPPDGGKKMNGEFIEFYASEALSCPRRIYFRLMGYPERWPENVKVRLTQGINTHGVLGEILNKRFGFELEKHLVLR
SRKLGFEIHGRIDAFREFPIEIKGKTSLPRVPYESHLAQLNVYLRWAEAEYGYLYYVKLHERPLTVISKLDFSNFPVIKG
PNFRAFEIPYDEKLFKETLRHFYNVKKAYERGKPPKGEYSYLCRFCPYRYLCYPEGNGFERD

>tg0677 CRISPR-associated protein, Cas4 family
ttgcgggccgatgaaccgcccgacggagggaagaagatgaacggggagttcattgagttctacgcaagcgaagcactgag
ctgtccgaggcgcatttactttcgtttgatgggctatccagagaggtggcccgagaacgtgaaggtcaggcttactcagg
gcataaacactcacggtgtcttaggagagatactgaacaagagattcggctttgagctggaaaaacacctcgttttgaga
tcgagaaagctgggatttgagatccacggcagaatagacgcctttcgagagttccctattgagattaagggtaaaacaag
cctccctagggttccctacgagtctcacctcgcccagctcaacgtgtaccttagatgggcggaggctgaatacgggtacc
tctactatgtcaagctccacgagagacctttaactgtgataagcaagcttgatttctccaattttcccgttatcaagggg
cccaacttcagggccttcgaaataccgtacgatgaaaaactctttaaggagaccttgcgccacttctacaacgtcaaaaa
agcttacgaacggggcaaaccaccaaagggggagtattcgtacctgtgcaggttctgtccctacaggtatctatgttacc
ctgagggaaacgggtttgagagggat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 642079 - 643744 (Additional range around tg0677 is :500nt.)

>Thermococcus gammatolerans EJ3 AAAAGGCCGGAGTTAGAATGAGAACGTATCGACCGGAGGTCGATGAGAAATATGGATGAAGACCCCTCAGGTAGTAGTTG GTTTTCGAGACTGTTTGGTGGAAAGAAAGAGTTCCTTCTTGAGCAGGATCTCAGCAGCAGGGCGTACGAGGAATACCGCA GGCTTCTCATGAAGGCGAGGCCCGAGGTCAAGGGGAAAGAACTGCGCCTTAAACTCCCCAGCGGGGAGGTGTTCCTCTCG GAAGGAAAGCTGAGGATACGGGCCCGTGATCAAAAAACCGCTGAAAAGATCCTGAGGAACCTCCACCACTACGAGCAGCC GCCAAGTCTCTGGCCGGCTTATGGGCTCAGTTACTCCCTGAAAAGACACGGTAGACCAAGGGTTCGAACTTAAGCGGGTT AAGGTTTTAAAATACTCCCCCCATTCCTATTTTGGATGACGACCCTTGCCCAGTCTGAGCTGTGATGACGTCGGTATTAG CTGACAGCGGGCGGGGAGG ttgcgggccgatgaaccgcccgacggagggaagaagatgaacggggagttcattgagttc tacgcaagcgaagcactgagctgtccgaggcgcatttactttcgtttgatgggctatccagagaggtggcccgagaacgt gaaggtcaggcttactcagggcataaacactcacggtgtcttaggagagatactgaacaagagattcggctttgagctgg aaaaacacctcgttttgagatcgagaaagctgggatttgagatccacggcagaatagacgcctttcgagagttccctatt gagattaagggtaaaacaagcctccctagggttccctacgagtctcacctcgcccagctcaacgtgtaccttagatgggc ggaggctgaatacgggtacctctactatgtcaagctccacgagagacctttaactgtgataagcaagcttgatttctcca attttcccgttatcaaggggcccaacttcagggccttcgaaataccgtacgatgaaaaactctttaaggagaccttgcgc cacttctacaacgtcaaaaaagcttacgaacggggcaaaccaccaaagggggagtattcgtacctgtgcaggttctgtcc ctacaggtatctatgttaccctgagggaaacgggtttgagagggat TGAACCCGCCCATATTTTTGGGTTCCGAGTTAT CTCCTACCGGAGGGCAAAGCTTATAAAAGACATCCCTCTCTATGAGTTCGAGGGCCCGTAGCCTAGCAGGATAGGGCGCC GGCCTTCTAAGCCGGAGGTCGCGGGTTCGAATCCCGCCGGGCCCGCCATTCTCGAAATAATCACTTCCATGCGCCTCACC TTTTCTAAATGCTCTTTAAGAAGCTTATTTGCGAGGGCCGAGAGATTAAAGCCCTCTTCTTTGAGACCGCCGACCACTTC TGCATCAAGGTACAAATGAACGCGCGTCTTTCGCTTCTTTTCGACCAAATCTCTGTTGAGAGCCCTGCCATATGACGGCC CACTATGGCCCACTTTGGCCCACCCGTGGGACAATGGCCGGAGGTGAATATTAAGACTACGGTCATGAGAATCACCTCAG CCAATCGAGTAAGGCATAGCGGAGGGCTATTGCAGAAATGTGGAACTTGTCGAGGTCGTTATCTTCA