tg0686

Coordinates:652403-653188

>tg0686 hypothetical protein TGAM_0686
MGDCKSIVAVFDKPWEEVLTRLKEEFGYLEEKRYEGDEGNREQFKFYDTRCFRLVSTGYVHFVMRTAEGFGPHECFIVNV
FSRGNSTIIDFESWTSRFDFILSSELMKLLKKLARVGALIICGYIYGHEKLRDVFGDYNQFLLYERLAKIVKEGKLEVLP
SDLTVVRGDILGLEDGLYELVGEPGLYVFVRDLGVEGYKVLLIVGDGLLDDVLYREVLEYENWFSLKITWVIFKRIGQKV
GNEELLKRAEDYFKAQVGEDGR

>tg0686 hypothetical protein TGAM_0686
gtgggggattgtaagagcatcgttgcagtgtttgataagccttgggaggaagtgttgacgaggcttaaggaggagttcgg
gtaccttgaagaaaagagatacgagggcgatgaggggaacagggagcagttcaagttttatgatacgaggtgctttaggc
tagtatccacaggatatgttcacttcgtcatgaggactgccgaggggttcggaccccacgagtgcttcatagtaaacgtg
ttttcaaggggaaactcaacaataatcgactttgaatcctggacgagcaggtttgatttcatcctgagctccgaactgat
gaagctcctcaagaaactggcgagagtcggagcactcatcatctgtggttacatctacgggcatgaaaagcttagggatg
tgttcggtgactacaaccaattcctcctgtacgagcggttggccaagatagtgaaagagggaaagctcgaagtcctcccc
tcggacttaaccgtcgtgaggggggacattcttgggctggaggatggtctctacgagctggtcggcgagcccggcttgta
cgtttttgtcagggatctgggcgtggagggatacaaagtgctccttattgttggtgatggactgttagatgacgtccttt
atagggaagtgctcgagtatgagaactggttcagcttaaaaatcacttgggtgattttcaagcgcattggccagaaggtc
gggaacgaagaactgcttaagagggcagaggactactttaaggcacaggtgggagaagatgggcgt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 651903 - 653688 (Additional range around tg0686 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGGAGAAGACTTTGATGAGGTAGTCAAGGCAATGCAGGGACTTGAGAGTCTCGGCATTAGAAGTGTAATATTGCAGAAG ATTATAATCGAGAAAGGCTGGGACGTTAAGAAGCTCGAAAGAGTCATCAATGACATAAAGGGTGTTCCCGGTGGAGACAG ACTCTTCACAAAAATCAAGCGCGGGATTGGAGACGGTTTCTATAAGGGAAGGTTTGTACTGGACAGGGTAAACTTAGGTC GAGTTTATATTGAGTGCTTTGGTGGTATAAGGCCCGAGCAAATATTGACCCAGGCGAAGTATGCTAAGAGCAGGGGCGTC AGGAAAATCTACGTGTACTACTCAAGGGACGTCTTCAGTCCGGGACAGCACTATCGGGTCATGGAAGCTATACGAAATGC GAAGTCCCGGTTTGGAGTGGACGTTGAGCTGGTTCAGCTGACTTCGGAGTTTAATTAAACCTTTTCCCAAATATTTTTTG AACTGCCGGGGGTGGTCGT gtgggggattgtaagagcatcgttgcagtgtttgataagccttgggaggaagtgttgacg aggcttaaggaggagttcgggtaccttgaagaaaagagatacgagggcgatgaggggaacagggagcagttcaagtttta tgatacgaggtgctttaggctagtatccacaggatatgttcacttcgtcatgaggactgccgaggggttcggaccccacg agtgcttcatagtaaacgtgttttcaaggggaaactcaacaataatcgactttgaatcctggacgagcaggtttgatttc atcctgagctccgaactgatgaagctcctcaagaaactggcgagagtcggagcactcatcatctgtggttacatctacgg gcatgaaaagcttagggatgtgttcggtgactacaaccaattcctcctgtacgagcggttggccaagatagtgaaagagg gaaagctcgaagtcctcccctcggacttaaccgtcgtgaggggggacattcttgggctggaggatggtctctacgagctg gtcggcgagcccggcttgtacgtttttgtcagggatctgggcgtggagggatacaaagtgctccttattgttggtgatgg actgttagatgacgtcctttatagggaagtgctcgagtatgagaactggttcagcttaaaaatcacttgggtgattttca agcgcattggccagaaggtcgggaacgaagaactgcttaagagggcagaggactactttaaggcacaggtgggagaagat gggcgt TGATAACTATATTTACCTCATGTTTGATAAAAAGCCGGAGGAGGTTGAGGATTTCCTTGAAAAAGAGTTTGAA GTTGAGATTCGGGACGGTGAATGGGATGATCCTCGGATGGATTACCTCAGGGAAAAGGGCCTTTTGGGAGATGATTTTCA GCTCGTTGTCTCGGGTGAACTGCTCTTTGACCCTTCGCTGAGGACTACGGAGTGGGGGGTTATAATCAACGCGGACTTCT ATGTTTACACGGTTAAGGGGTACACAATCCTCGAAATTCATCCAGTTTCGAGGAGCAGATGGCGGTTCGTCCTCAGTTCG GAAGTCATCAGGCTCTTAAAACAGTTCATGAAGGCAGAACCCCTCCTAATATGCGGCTACCGAGATGATACAGACCTGAC GAAACTCGGCTTCGAGTACAACATGTCTTACCTGTTCATAAACTGGCTTCCCGAGGCAATTAAAACTGGAAAACTCGAAA TCCTGCCCTCAGCCCTCACAGCAGTAA