tg0688

Coordinates:654306-654488

>tg0688 Methyltransferase C-terminus, putative
MKPDGSVRVFMVDDELNIYTVREMRLLAEKHFGKVPNLRGRARAEAQRPAVLAGGGEIMQF

>tg0688 Methyltransferase C-terminus, putative
gtgaagcctgacgggagcgttagggtcttcatggtggacgacgaactgaacatttacaccgtaagagagatgagacttct
ggcggaaaagcacttcgggaaggtcccaaatctacggggacgggcacgagctgaggcccaacgaccggcggtactggctg
gtggcggtgaaataatgcaattt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 653806 - 654988 (Additional range around tg0688 is :500nt.)

>Thermococcus gammatolerans EJ3 CCACACGACCACCACGACTACTACGACCACTACTACGACTACGACGACTTCTAAGGGCGGTGGAGGCACCAAGATCTGCG GTCCAGCGGCCCTCATAGGCCTCGCAATAATCCCACTCCTCCTCAGGAGGAGAAAGTGACCCTCTTCCCCTCTTTTTGTT TTCTACAAGTTTCAAGACAGGCTTTTATCGGGAAACGCTGAAACTTTTCTGGTGGTACCATGCACGAGCTCTACACCGTT CTGGCCGAGTACTACGACGCGATTTATAGGAGAAGGGCCGAGCGGGTTTCTCGGGAGATAGACTTCGTGGAGAAATTATT TCAGAATGAAGCCGAACGAGAAGTGAGGAAAATCTTAGACCTCGCCTGCGGAACCGGGATTCCGACGCTCGAACTGGCAA GGCGCGGGTATCGGGTTATGGGCCTTGATCTCCACGAGGAGATGCTCGCCGTTGCAAGGCGGAAGGCCAAAACTCCACTT CAAGAGGCTCGTGCAGATA gtgaagcctgacgggagcgttagggtcttcatggtggacgacgaactgaacatttacacc gtaagagagatgagacttctggcggaaaagcacttcgggaaggtcccaaatctacggggacgggcacgagctgaggccca acgaccggcggtactggctggtggcggtgaaataatgcaattt TAAAAAGTAATCCTCTTTTGATTGCTTTTGCCTTGT TAAAACTTCCAATAGAAAAATTTTTAAGTTCTGGATTTATTGTCCGTGCGGGCAACTCTAAGGAGGTGCTCCGCCTGGGC TGGCGAAGGGTTCTCGCCCTGGCCCTCGTGTTGCTATTCCTTGGAATGACAGTTAGTGGTGCCAGTGCCACTGCCACCTT TGTTAACGCGACGGTTAACAATACAGTAGCGGTTCCCCCGGAGTTCGGTCCGGAGAAACAGCCTGGAGACGAGATTCGGC CGCAGTTCTGGTGGATTATAGGTCTCATAATACTTGACTTGGCCGTTCACTGGTTCCTTGAGCACTACATCTCTCCAGAA GTTGCGGCAGTCTACGATGCAGTCACGATGTTCATCGACCCTGAGAAGATTGCAGAGAAACTTGGAATCAAGGGAGCAGA ACTCGGAATTAAAGTGATCAGCCGCAATAAAGTGCTAATCGGCCTGTTCAAGGACAACAAAGTT