tg0693

Coordinates:660496-660663

>tg0693 Plasmid stabilization system addiction module toxin, RelE/StbE family, C-term part
MRQSPRDKFDIIKLKGSGDLDIYHVRIGEYRIIYSVNWKARRILIHKVKKREDAYK

>tg0693 Plasmid stabilization system addiction module toxin, RelE/StbE family, C-term part
atgaggcagtccccccgggacaaatttgacataattaaacttaaaggctcgggagaccttgatatttaccatgttagaat
cggcgaataccgcattatctattctgtgaactggaaggcccgtaggattctaattcacaaggttaagaaaagggaagatg
catacaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 659996 - 661163 (Additional range around tg0693 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAAGATTTCCTCCCTCTTGCTCTTCGGCCTCGGGTCAAACAGCATAGGTATCGCCCCCGATACTAAGTATCGGTACCGG TACTTAAAGGTTCCGAAACGATGCATATTATCATCATTTGAACGAGCGAATCAAAGGGAAAATTAAAATATCATGCCGAA AGAATTCAAAGTGGTGAGAACATGGAGCGGGTAAGAGATGTCAACGTGCGTTACGTTATGGAAGAGCTTGAGCGCCTGAA GGTGGAAATCCAGCGTCTTGAGGCTATGCTGGTTCCCATTGTGAGGGGTGAAGTATCCGATGAAGAACTTGATAAGATAG AAAGAGAAGCAAGAGATTTCAAGGAAGAGAACTGGATTGACGCGGACGAGCTTGAGCGGATTCTGGAGGAAGACTCATGA CTTTCGAGGTCAAAATAAAGAAAGAGGCAATTAAGGCTCTGAAGTCCTTACCGAAGGCTAACCTCAGAAAATTTTTGGAG TTAAAGGACGCGCTTAGAT atgaggcagtccccccgggacaaatttgacataattaaacttaaaggctcgggagacctt gatatttaccatgttagaatcggcgaataccgcattatctattctgtgaactggaaggcccgtaggattctaattcacaa ggttaagaaaagggaagatgcatacaaa TAGCTCAGTGAATCTTGTACCTCAGAAACGCTCCAAGCCCGCCAAAGGCCT TGTAGAACTGCTGTCCCTCCTCGGTGTCGAGGGAAATTATCTCCACGTTTGAACCGGCTTCCTCTGCCATCTTGATGAGC TCCTCCGCGACGTCCCACTTCTCGAAGGTTATGTTCTGACTGCCACACTTGGGACAGTGGGTCAGCTTCTTCTTGTAGAC GTGGAATTCCTGCTCGCTCATCGTCTTCTCCTCGCTCCAGCCACAGTTGTTGCACTTTGCCCTGACGCGGACCTTATCGT AGCCCTCACTGATGAGGAGCGTGTCAACGGCGCCGAGCTCAAGCGCTTGCCTGACTTCTTTCTCACCGTAGGTTATCATC CCCGTGTCCTTGACGAGGTGCTTGAAGAAGTCCTGGATGAGCTTCCTCTCCTTTACGGCCTCGTGATCCCTGAGTATGTC GCTGGCCTTCTCGACGAGCTCCCTTAGGCCGTACTCGCCGTGGTAGCTT