tg0699

Coordinates:664479-665030

>tg0699 hypothetical protein TGAM_0699
MRAKELAIGQLLRLAVGFVVSAFLGVLVAVVFPKTAANLFVEIGKSIAGKVGDREGFGAFLSIYTNNLTVATSAYALGIF
FGIVPWIIVLVNGFILGLVLAVVVSTGLISPVTAMLAVLPHGIFEIPAILLAAAAGILVYRGTLKKEGMEVVYASLKLYA
LSAVLLLVAAFIEAFITPKVAGIG

>tg0699 hypothetical protein TGAM_0699
atgagggccaaagagctggcgataggccagctcctccggttggcggttgggttcgtggtgagcgcctttctgggcgttct
ggttgctgtcgtttttcccaaaaccgccgcaaacctcttcgttgagattgggaagtcgatagccggtaaagttggggatc
gagagggctttggcgcgtttctgtcgatatacaccaacaacctcaccgttgccacttctgcctacgccctcgggatattc
ttcggcattgtgccctggatcatcgttctggtgaacggcttcattctgggcctcgttttggccgttgtagtgtctacggg
gcttattagcccagtaaccgcgatgctcgccgtgctccctcatgggatatttgagattcccgctatactcctggcggcag
cggctggaatactggtttacagggggacgcttaagaaggagggtatggaggttgtttacgcctccctcaaactctatgcc
ctctccgccgtcctgctcctcgtggcggctttcattgaggccttcataaccccaaaggtggcgggcattgga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 663979 - 665530 (Additional range around tg0699 is :500nt.)

>Thermococcus gammatolerans EJ3 GCCGAGCTCGAGGCTCGGTGTGTCGTCGAAGGTTATCTCTCCTTCCCACTTCTTTCCTGCCTCGGTGAGCATCTCGTCGA GTGCCTTCTTCAGAGAAAGCCTCGCCCTCTCCCGTATCTCTTTATAGACCATCTTCACCACCGCTCCCACTTTAACCCAA CCTTTAAAAAGTTCTCCCGCGAGCTTACAACGGGGATGGGTATGAAGCATCACGTCGGTGAGCACAAAGCGAAAAAGGGC CTCATAAGGATTGAGTTCGACGAGAGGGACGGCATAGCCGAGCACGTTAAGATTACGGGAGATTTCTTCATGCACCCTGA GGAGGCAGTCCACGACCTCGAGAAGAAGCTGGAAGGACATAAAATCGAGGAGCTTGAAAGCCTGATTGACGAGTTCTTCG CGATGCGCCTCGATGTCGAGATGCCGTACGTGAACGTCGAGGACTTCAAGATTGCCCTCAAGAAGGCCCTGGAGGGGTGA GGGTGAGGCTTTCGCTGGGG atgagggccaaagagctggcgataggccagctcctccggttggcggttgggttcgtggt gagcgcctttctgggcgttctggttgctgtcgtttttcccaaaaccgccgcaaacctcttcgttgagattgggaagtcga tagccggtaaagttggggatcgagagggctttggcgcgtttctgtcgatatacaccaacaacctcaccgttgccacttct gcctacgccctcgggatattcttcggcattgtgccctggatcatcgttctggtgaacggcttcattctgggcctcgtttt ggccgttgtagtgtctacggggcttattagcccagtaaccgcgatgctcgccgtgctccctcatgggatatttgagattc ccgctatactcctggcggcagcggctggaatactggtttacagggggacgcttaagaaggagggtatggaggttgtttac gcctccctcaaactctatgccctctccgccgtcctgctcctcgtggcggctttcattgaggccttcataaccccaaaggt ggcgggcattgga TGAGCACCTATGAGTTCTCTAGGAACCGATCAAGATGAGCTGCTATCTCCCTGGCGACCATTTTGT AAGGATCTCCCTCTCTAAGCCTCCCTACCCTGGCCTTCAGGTTCCACCAGTAGGCGACCCAGACTGTCTGGTTCATGATG TGCTCCTCGTTTAGCCTCCTGACGCTTGAAAACTTCAACTCAAGGGCGGGCTTTTTGATTGTTCCTTTGGTCTCTTTTGA GGTATTCCGGCTCATCATGATATCGACGAAAGTTTTGGCGTCGCCGGCGTAGGAGTAATAGAGGATTCCCGAAACACCGC ACTCACGGGAGAGGAGACCGTCCCTGGAAAAGGCGTGGGGCAGATAAACTACCACGACTCTGCCTTTCATGTCGTGGTCA TCTATTGAGCCGCTGACGTAAACCGGCTTTAAGTTATGGGCGCGGGTCACGTTGGTGAGGGCCTCTCTAAGGGCCTTCTT AAGCCGGACGTTTGGGGCGACGATTTCAATGTA