tg0700

Coordinates:665041-665706

>tg0700 hypothetical protein TGAM_0700
MKRWLALGISILVLLSVLVVTTASESTVLSELSGESQYGGSLIPNSSGWRSAPEDPQTVYIEIVAPNVRLKKALREALTN
VTRAHNLKPVYVSGSIDDHDMKGRVVVVYLPHAFSRDGLLSRECGVSGILYYSYAGDAKTFVDIMMSRNTSKETKGTIKK
PALELKFSSVRRLNEEHIMNQTVWVAYWWNLKARVGRLREGDPYKMVAREIAAHLDRFLENS

>tg0700 hypothetical protein TGAM_0700
atgaagcgctggttggccctcggcatctcaatccttgtgctcctatccgtccttgtcgtgacaaccgccagtgaatcaac
cgtactatctgaactctctggtgaatcccaatatggtggttctctcattcccaacagctccggctggaggagcgctccgg
aggatccgcaaacggtctacattgaaatcgtcgccccaaacgtccggcttaagaaggcccttagagaggccctcaccaac
gtgacccgcgcccataacttaaagccggtttacgtcagcggctcaatagatgaccacgacatgaaaggcagagtcgtggt
agtttatctgccccacgccttttccagggacggtctcctctcccgtgagtgcggtgtttcgggaatcctctattactcct
acgccggcgacgccaaaactttcgtcgatatcatgatgagccggaatacctcaaaagagaccaaaggaacaatcaaaaag
cccgcccttgagttgaagttttcaagcgtcaggaggctaaacgaggagcacatcatgaaccagacagtctgggtcgccta
ctggtggaacctgaaggccagggtagggaggcttagagagggagatccttacaaaatggtcgccagggagatagcagctc
atcttgatcggttcctagagaactca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 664541 - 666206 (Additional range around tg0700 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCTGTCATAATCTTCGGGATCAACGACGACGAGGCGGAGGCCTTCATAGAGTTCGCAAGGAAAATCGGCGCTGGAAAGC GCTGGCCGGCCCTCGGTTTCCAGAACTACGTTCCCTACAAGTTCGGGAGGAATCCAGTCATAGCGAAGCCCGTTCCCTTC AAGGAGTTCTACGCCTGGCTGAGGAGGCTTGAGGAAAAGACAGGGATGAAGCCCCTCGTCCTGAAGCCGAGCCACTTTGG CATGGAGAAGAGGGAGTTCATACCGCTGGCCTTTCGGCCCGGAGAAATAGTTAAGGCCGAGGTCGTCCTCCCGGGCAGGA TTGAAGGAGAGATGCTTGCAAAGGCCAGGAACAGGCTCATAGAGGTCGTTGGAACGAGGGCGGAAGTTGGAGACAGGATA AGGGTGAGAATAGTGCGGACGAGACACGGGATTTACATCGGGAGGGAAGTCTAAAAAACTTTTTAAAGTAATTTTTTCGA CTATTCCCTGTGAGGGCGT atgaagcgctggttggccctcggcatctcaatccttgtgctcctatccgtccttgtcgtg acaaccgccagtgaatcaaccgtactatctgaactctctggtgaatcccaatatggtggttctctcattcccaacagctc cggctggaggagcgctccggaggatccgcaaacggtctacattgaaatcgtcgccccaaacgtccggcttaagaaggccc ttagagaggccctcaccaacgtgacccgcgcccataacttaaagccggtttacgtcagcggctcaatagatgaccacgac atgaaaggcagagtcgtggtagtttatctgccccacgccttttccagggacggtctcctctcccgtgagtgcggtgtttc gggaatcctctattactcctacgccggcgacgccaaaactttcgtcgatatcatgatgagccggaatacctcaaaagaga ccaaaggaacaatcaaaaagcccgcccttgagttgaagttttcaagcgtcaggaggctaaacgaggagcacatcatgaac cagacagtctgggtcgcctactggtggaacctgaaggccagggtagggaggcttagagagggagatccttacaaaatggt cgccagggagatagcagctcatcttgatcggttcctagagaactca TAGGTGCTCATCCAATGCCCGCCACCTTTGGGG TTATGAAGGCCTCAATGAAAGCCGCCACGAGGAGCAGGACGGCGGAGAGGGCATAGAGTTTGAGGGAGGCGTAAACAACC TCCATACCCTCCTTCTTAAGCGTCCCCCTGTAAACCAGTATTCCAGCCGCTGCCGCCAGGAGTATAGCGGGAATCTCAAA TATCCCATGAGGGAGCACGGCGAGCATCGCGGTTACTGGGCTAATAAGCCCCGTAGACACTACAACGGCCAAAACGAGGC CCAGAATGAAGCCGTTCACCAGAACGATGATCCAGGGCACAATGCCGAAGAATATCCCGAGGGCGTAGGCAGAAGTGGCA ACGGTGAGGTTGTTGGTGTATATCGACAGAAACGCGCCAAAGCCCTCTCGATCCCCAACTTTACCGGCTATCGACTTCCC AATCTCAACGAAGAGGTTTGCGGCGGTTTTGGGAAAAACGACAGCAACCAGAACGCCCAGAAAGGCG