tg0714

Coordinates:675796-676977

>tg0714 membrane bound oxidoreductase, MbxL subunit (MbxL)
MANLEVPKELREEARKHDMYLTPIAKDTYELFFGPQHMATENFSIILKMDGNRVERAIVNPGFLHRGFEKLAEGRPYFTN
IALLLRICVPESDVPENIYSMAVDEIVGWEVPERAIWIRTTVLEMARLSAWMFWIMGFGNEIGLYTAGQWAAAYRERLMR
LFEELTGGRVYHIYTVPGGVRRDIPGDRWLRQLRDTVEYIKSKLKDFDEILFDNYITFERTEGVGVMDKKFALKHAVTGP
NLRAVGVPYDVRKDDPYYLYPELDFEVPVLKEGDSLARVLVRRYEIEQDLYILEQLLDMGPPSGPYMVQDPKLKNLPRFK
VPAGDAYAHVESTKGDFGAYVVSDGTHKPYRVHVRGPSQSHGVTVLEELLKGARLADVPVILKTLDNCPPDIDR

>tg0714 membrane bound oxidoreductase, MbxL subunit (MbxL)
ATGGCGAATTTGGAGGTTCCAAAGGAGCTTAGGGAGGAGGCGAGAAAGCACGATATGTACCTCACACCAATAGCCAAAGA
CACCTACGAGCTGTTCTTCGGCCCACAGCACATGGCTACCGAGAACTTCAGCATAATACTCAAGATGGACGGCAACAGGG
TTGAGAGGGCCATAGTCAACCCGGGTTTCCTGCACAGGGGTTTCGAGAAGCTCGCCGAGGGGAGGCCTTACTTCACAAAC
ATAGCGTTACTCCTCCGCATCTGCGTTCCCGAGAGCGACGTTCCCGAGAACATCTACTCGATGGCCGTTGATGAAATAGT
CGGCTGGGAGGTTCCTGAGAGGGCGATATGGATTAGAACGACAGTGCTTGAGATGGCAAGGCTTTCAGCGTGGATGTTCT
GGATAATGGGCTTTGGAAACGAGATAGGCCTTTACACTGCAGGCCAGTGGGCCGCGGCCTACCGTGAGAGGCTCATGCGC
CTCTTTGAGGAGCTAACCGGCGGGAGGGTCTACCACATCTACACCGTCCCCGGGGGAGTTAGAAGGGACATACCCGGTGA
CAGGTGGCTGAGACAGTTGAGGGACACCGTCGAGTACATCAAGTCCAAGCTCAAGGACTTCGACGAGATACTCTTTGACA
ACTACATAACCTTCGAGAGGACCGAGGGAGTCGGCGTTATGGACAAGAAGTTCGCGCTGAAGCATGCCGTGACAGGACCG
AACCTTAGAGCTGTTGGAGTCCCCTACGACGTCAGGAAAGACGACCCCTATTACCTCTACCCCGAGCTCGACTTCGAGGT
TCCAGTCCTGAAAGAGGGCGACAGCCTCGCGCGCGTCCTCGTGAGGAGGTACGAGATTGAGCAGGATCTCTACATACTCG
AACAGCTCCTCGACATGGGGCCGCCGAGCGGGCCCTACATGGTGCAGGACCCCAAGCTCAAGAACCTGCCGCGCTTTAAA
GTTCCCGCCGGAGACGCCTACGCCCACGTCGAGAGCACCAAGGGTGACTTCGGGGCCTACGTCGTCAGCGACGGAACCCA
CAAGCCGTATCGCGTTCACGTCCGCGGACCGAGCCAGAGTCACGGCGTCACGGTGCTTGAGGAGCTCCTTAAGGGAGCCC
GCCTGGCAGATGTGCCCGTCATATTGAAGACCCTCGACAACTGTCCGCCCGACATAGACAGG


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 675296 - 677477 (Additional range around tg0714 is :500nt.)

>Thermococcus gammatolerans EJ3 CGTTAGAGAGCTCCTCGAGAAGGCCCCCTACGCTGAAGGCAAAGTTAGGCGCGAGAGAAGGATAGAGTTCAAGGTTCCTG CCGAGAGGATACACGAGTTCCTCGAGCTGGCGAGCGAGAAGTTTGAGATGCTCATGCAGATAAGCGTTGTCGATTGGCTC AAGCAGGGTGAGTTCGAGCTCGTTTACCAGCTCTGGAGCGTCAGTGAGAGCGTTCACGCCTTCGTGAAAACAAGGGTTCC GAGGGACAGCGCAGAGGTGCCGACGGTAATGGACATATGGCCCGTTGCAGAGACCTACGAGAGGGAAGCCCACGAGTTCT TTGGAATAATCTTCAAGGGCAACCCGAGGCTTGGGCCGTTCATCCTCGAGCCGAGGGAGTACGAGAAGCACCCGCTCAGG AAGGACTTTAACACCCTTAGCTACGTCAAGACAATCTACGGCGAGGACTTCGACAGGTATGACGAGAGTAAGACCAACTA CGTGATATGAGGTGATGCTC ATGGCGAATTTGGAGGTTCCAAAGGAGCTTAGGGAGGAGGCGAGAAAGCACGATATGTA CCTCACACCAATAGCCAAAGACACCTACGAGCTGTTCTTCGGCCCACAGCACATGGCTACCGAGAACTTCAGCATAATAC TCAAGATGGACGGCAACAGGGTTGAGAGGGCCATAGTCAACCCGGGTTTCCTGCACAGGGGTTTCGAGAAGCTCGCCGAG GGGAGGCCTTACTTCACAAACATAGCGTTACTCCTCCGCATCTGCGTTCCCGAGAGCGACGTTCCCGAGAACATCTACTC GATGGCCGTTGATGAAATAGTCGGCTGGGAGGTTCCTGAGAGGGCGATATGGATTAGAACGACAGTGCTTGAGATGGCAA GGCTTTCAGCGTGGATGTTCTGGATAATGGGCTTTGGAAACGAGATAGGCCTTTACACTGCAGGCCAGTGGGCCGCGGCC TACCGTGAGAGGCTCATGCGCCTCTTTGAGGAGCTAACCGGCGGGAGGGTCTACCACATCTACACCGTCCCCGGGGGAGT TAGAAGGGACATACCCGGTGACAGGTGGCTGAGACAGTTGAGGGACACCGTCGAGTACATCAAGTCCAAGCTCAAGGACT TCGACGAGATACTCTTTGACAACTACATAACCTTCGAGAGGACCGAGGGAGTCGGCGTTATGGACAAGAAGTTCGCGCTG AAGCATGCCGTGACAGGACCGAACCTTAGAGCTGTTGGAGTCCCCTACGACGTCAGGAAAGACGACCCCTATTACCTCTA CCCCGAGCTCGACTTCGAGGTTCCAGTCCTGAAAGAGGGCGACAGCCTCGCGCGCGTCCTCGTGAGGAGGTACGAGATTG AGCAGGATCTCTACATACTCGAACAGCTCCTCGACATGGGGCCGCCGAGCGGGCCCTACATGGTGCAGGACCCCAAGCTC AAGAACCTGCCGCGCTTTAAAGTTCCCGCCGGAGACGCCTACGCCCACGTCGAGAGCACCAAGGGTGACTTCGGGGCCTA CGTCGTCAGCGACGGAACCCACAAGCCGTATCGCGTTCACGTCCGCGGACCGAGCCAGAGTCACGGCGTCACGGTGCTTG AGGAGCTCCTTAAGGGAGCCCGCCTGGCAGATGTGCCCGTCATATTGAAGACCCTCGACAACTGTCCGCCCGACATAGAC AGG TGATGACGATGGCTAGAGTCGTTGGTGAGGAAAAGGTCAAGATCAAGAAGTCCTTCGTCAAGCCTTGGATGGGTAT CAAGTACCTCTTCAAGAAGCCCGTGACGATAAAGATACCCTTCGAGAAGATAGAGCCTGCTCCAAAGTACAGGGGATTCC ACACGCTCGACTGGAAGAAGTGCGTTGGTTGTAACTTCTGCGGTCAGATATGTCCGGCAAGGGCAATAGAGATGACGTGG CTCGAAGTGGACGGCAAGATGGAGAAGAGGCCCCACCCGAAGATCGACTACGGACGCTGTACCTTCTGCCAGTTCTGCGT CGACGTCTGTCCGACGGGAGCCCTCGGCTTCAGCGAGGCCTACCTCCTGACCACCGATGGAACGGAAGATGCGTTAGAGC TCTTCAACTGGGTGCCGATTCACCCCGATAAAGTACGGGAGCTCAACGAGAAGTTCGGTGACTACCGCTTCCCAGTTGTC AAGATTGAGAAGAAAGCCGATGG