tg0726

Coordinates:687308-687484

>tg0726 hypothetical protein TGAM_0726
MAEIIVKSKVKEFVKSLDAEMRVSPEFYDALEAEVKVLIEKAVKRAKEEGRKTLYARHV

>tg0726 hypothetical protein TGAM_0726
atggccgagattatagttaagtcaaaggttaaggagtttgttaagagccttgacgcagagatgagggtcagcccggagtt
ctacgacgcccttgaggctgaggtcaaggtcctcatcgagaaggccgtcaagagggccaaggaagagggcagaaagaccc
tctatgccaggcacgtc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 686808 - 687984 (Additional range around tg0726 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCAGGGGACGGGGTTTGAATACAAAATCTGCCCCCCTGTAGGTAACACCGTGAAGAAGGCAGAGTGATGCTATCCTGAA CCGATCCTCGTAGCCAACGATAGGCTCGTCGCTGAGGTCCACTACTTCTTTTACTCCCGGGTTCTCAGCGAGGGCCCTCG CGAGGGCCGTTAGGTAATCATCGTGACGGTAGATGGGCACACCGAGACGTCTTTCGACTTCCTCCAAGCTGCCTATTTTC TCCGAACCTCCGAGGAAAACCGCACAGCAAACGTTTCCAAGCTTATCAAGGGCCCATTTGACAACATCCGGGTAATGCTC GCCGTCTATGAGTGCTATCTTCATGGGGCCCACCAATAGGATTACCAGGGGAGAAGATTTAACCTTTTGTGTTGCGAGAC TCTAAGGCTCTGTCTCGTTCAATGGGAAGAGTTATAAACTCTCCATACCAGATATAGACGGCGCTGTCCACCGGACAGCC CGCAAAGGAGGTGTTGAAAA atggccgagattatagttaagtcaaaggttaaggagtttgttaagagccttgacgcaga gatgagggtcagcccggagttctacgacgcccttgaggctgaggtcaaggtcctcatcgagaaggccgtcaagagggcca aggaagagggcagaaagaccctctatgccaggcacgtc TGATTTTTGGATACCCTTTTATTCTCCCTTTCCAATATTCT CAGGTGGTTTCATGGGCCTTAGAAAACTGTCTGATTTTGCGTACCTTTATCCGGGCAGCCCTTCAACGCTCCTCCGCGTT CACAACGGGAAGCTAGTGATAGTTGATCCCGGTCACGGAAAGGGGAGGCACAAGGATCTAAAACGGGAATCCAGAAAGCT GGGTCTCGAGATCAAAGCCCAGCTCGTCACGCACGGGCACGCAGATCACGTTGCGGTTTCCACAAAGCTCGAAGCCCCTC TTTACATCCACAGGTTCGAGTTCTCCATCGCTGAAAGCCCGCTCGCAAGGGAGATCATAACCTTCGGGGCCAAAGCGCCC AAGGGATTCCTCGTCTTCCAGTTCCCTGAGGAAGTCAGGGTTCACGCGGTTTTCGAGTGGGGCGATGATCTCTTCGGTCT CAAGGCCCTGAACCTTAGCGGCCATTCACCGGGAATGACCGGTTTCTTTGACCTGGAG