tg0742

Coordinates:703439-704197

>tg0742 Acetyl-CoA synthetase (ADP forming), beta chain (acdB)
MKEEALKVIESVLSQGRTAMVEYEAKQVLKAYGLPVPEEKLAKTLDEALKYAEEIGYPVALKLMSPQILHKSDAKVVMLN
IKSPEELKQKWEEIHENARKYRPDAEILGVLVAPMLRPGREIIIGVTEDPQFGHAIMFGLGGIFVEVLKDVTFRIIPITE
RDARKMITEIKGYPILAGARGEEPADIDAIVDLLLKVSQLVDELRDYIKEMDLNPVFVYEKGKGAVIVDARIILKEPEEK
KPEVSSEYKERCA

>tg0742 Acetyl-CoA synthetase (ADP forming), beta chain (acdB)
atgaaggaggaagccctcaaagttatcgagtccgtcctgtcccagggcaggacggctatggttgagtatgaggccaagca
ggttttaaaagcttacggccttccggttccggaagaaaagctcgccaagaccctcgatgaggctctcaagtatgcggagg
agataggctatcccgttgccctaaaactcatgtcgcctcagatactccacaagagcgacgcgaaggtcgtcatgctgaac
ataaagagccccgaggagctcaagcagaagtgggaggagatacacgagaacgcgaggaagtaccgccccgacgccgaaat
cctcggcgttctggttgccccgatgctcaggcccggcagggagataatcataggcgttacagaagacccgcagtttggcc
acgcgataatgttcggtctaggcggaatattcgtcgaggtcctcaaggacgtcaccttccgcataatcccgataaccgag
cgcgacgccagaaagatgataacggaaatcaagggctatccgattctcgcgggggcgcgtggagaggagcctgccgacat
agacgccatcgttgaccttcttctcaaggtcagccagctggttgatgagctcagggactacatcaaggagatggacctca
acccggtcttcgtctacgagaagggcaagggcgcggttatagtcgacgctaggatcattctcaaggagccggaggaaaag
aagcccgaggtaagctccgagtacaaggagaggtgtgcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 702939 - 704697 (Additional range around tg0742 is :500nt.)

>Thermococcus gammatolerans EJ3 GCATAATCACCGACGGCGGTGGCGCCGGAGTCATGGCCAGTGATGCCGTTGCCAAATTCGGTCTCAGGATGGCCGAGCTG AGCGAGGAGACGATAAAGTTCCTCAAGGAAAACTTCCCGCCGCACGCGGTGGCAGGAAACCCGACCGACGTCGTTGGAGA TACCGACGCCGAGCGCTACAGGGTGGCCATCGAGGGCTTCGTGAACGACCCCAACGTTGACGCGATACTCGTCATAGTGC TCTTCCAGGTCCCGCTCCTCGAGGAGGAGAAGATAATCGACATTCTCGCCGAGTACCAGAAGAAGAGCGACAAACCGATT GTGGCCGTAGCTATGGGCGGTAAGAAGACCGACCGCTACGCTAGAATGCTGGAGGAGAAGGGCGTTCCCGTTTACCCGAC TCCCGAGAGGGGCGTCCGCGCTCTGGCGGGTCTCGTGAGGTACGCCGAATATTTGAAAAAAGTTAAAGGTGAGTGATGTT TACCCACTGGTGGTGGTAGT atgaaggaggaagccctcaaagttatcgagtccgtcctgtcccagggcaggacggctat ggttgagtatgaggccaagcaggttttaaaagcttacggccttccggttccggaagaaaagctcgccaagaccctcgatg aggctctcaagtatgcggaggagataggctatcccgttgccctaaaactcatgtcgcctcagatactccacaagagcgac gcgaaggtcgtcatgctgaacataaagagccccgaggagctcaagcagaagtgggaggagatacacgagaacgcgaggaa gtaccgccccgacgccgaaatcctcggcgttctggttgccccgatgctcaggcccggcagggagataatcataggcgtta cagaagacccgcagtttggccacgcgataatgttcggtctaggcggaatattcgtcgaggtcctcaaggacgtcaccttc cgcataatcccgataaccgagcgcgacgccagaaagatgataacggaaatcaagggctatccgattctcgcgggggcgcg tggagaggagcctgccgacatagacgccatcgttgaccttcttctcaaggtcagccagctggttgatgagctcagggact acatcaaggagatggacctcaacccggtcttcgtctacgagaagggcaagggcgcggttatagtcgacgctaggatcatt ctcaaggagccggaggaaaagaagcccgaggtaagctccgagtacaaggagaggtgtgcc TGACTTTTTCTCCCATTCT ACCCTTTTCGTGAAGTCGTCGTTGTTTAGTGTAAGTCTTGAGAATAAGCCTGGAGGAATACCAGAGATCCCAAAGCGAAC TCTTGCAGAGAAGTTGCAAAAAGGGAAGTATAAATAAAAACCATCACTCAATCTTTGCACCGCAGACAGGGCAGAACTTC GCTCCCTCTGGAACTATGTGGCCGTTGGGACAGCGCTTGATTTCATGGCCGCAGTAGGGACAGAAGCGCGCCCCCGGTGG AATCGGCTTGCCGCAGTAGGGGCAGATTTCCTGCTGTTGGGTCTGGGCAGGTGCCGCTTGCTGGGGTTGCTGTGGTGCTG GAGGGGTGCCCCCACCCGCGTAGGGCTGGGCCGGTGGAATCGGCTGGGCCTGCTGCTGGAAGAGCTGCGGCACGAGTACC ATCCCGGTTCCCATACCGGCCCCGGGACTTTTGCCGAGCTCGGCCGCGACCTGCTTCACCGTGTCCATCTGCATAACCGC