tg0747

Coordinates:707856-708284

>tg0747 Phosphoribosylaminoimidazole carboxylase, catalytic subunit (AIR carboxylase) (purE)
MKVLVVMGSKSDSHVAEKVTSVLDEFGVEYDIEVASAHRNPKKVEELARKDYDVFIAIAGLSAALPGVIAAHTIKPVIGV
PVSAKLGGLDALLSMAQLPPGVPVATVGIDNGKNAALLAIEILALRDERLREKLKEHREKMRG

>tg0747 Phosphoribosylaminoimidazole carboxylase, catalytic subunit (AIR carboxylase) (purE)
gtgaaagtcctggtggttatgggaagcaagagtgacagccatgtagctgagaaggtaacttcagttctcgatgagttcgg
ggttgaatacgacatcgaagttgcttccgcccacagaaatcccaagaaagtcgaggagctggccagaaaggactacgacg
tattcatagcgatagccggcctgagcgccgcgttgcccggagtgatagcggcccacacaatcaaaccggttataggggtt
ccagtctcggccaagctcggtggtctcgacgcgctcctaagcatggcacagcttccgccgggagtgcccgttgcaacggt
ggggatagacaacggtaagaacgcggcccttcttgccatcgagatcctcgcgctgagggatgaaagactgagggagaaac
tcaaagaacatagagaaaagatgcggggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 707356 - 708784 (Additional range around tg0747 is :500nt.)

>Thermococcus gammatolerans EJ3 GCCTATTGACATCGATACACTGAACGAGAAATACATCCGGGTAATCGGAGCCCACAAGCAGAAGTGGGCAGAGATGGGGA TGTTCAAGGGGAGGGAGCTGTGGGGTATTACAGTTTCTATGTCGGATTATCTCTCCATATTCACCCCCAAGGCAACCCAG AGGTATCTGGAGATCGCCGACCTCCAGAGAAGTAGATCCGAGATATATAAAAAGTACCCCGCGGGGACGAACGTGTGGAC ATACACCGGCGAGGACACGATGGTACTGCCCCTCCTCTACCGCAAAGCTGATTACGTTCTCAAGACGGAGAGCAGAATAG AGGACGACAAAATTAAAAGGTACCTTCACATCGTCAAAGCCCCCGAGCTGGGGGACGTTACAACACTGGAGTACGACTTC AAAGGAGGACGGATTCACTTCCAATGAGTTGACATTTCAACGTTAATTTACTCGCAAATTTTTTAAATTTTAGACATGTT TCTGTGAACGGTGGTTCCG gtgaaagtcctggtggttatgggaagcaagagtgacagccatgtagctgagaaggtaact tcagttctcgatgagttcggggttgaatacgacatcgaagttgcttccgcccacagaaatcccaagaaagtcgaggagct ggccagaaaggactacgacgtattcatagcgatagccggcctgagcgccgcgttgcccggagtgatagcggcccacacaa tcaaaccggttataggggttccagtctcggccaagctcggtggtctcgacgcgctcctaagcatggcacagcttccgccg ggagtgcccgttgcaacggtggggatagacaacggtaagaacgcggcccttcttgccatcgagatcctcgcgctgaggga tgaaagactgagggagaaactcaaagaacatagagaaaagatgcggggt TGACTTTTTCATTCTTACTTGCGTGTCGTT ATGGAAAAAGGCGAAAACATCAGAATTCATCCCAATTCCCATAGACACCCTTAAATAGTAGTTTTGCCTAACTACTGTGA GTGATGACGATGGAGGCCCTGGCCTTTAAGTGCGAAAGGTGTGGTGCGCCCCTAGAGGTGTCGCCCGAGACTATCGTGGC GGTCTGCCCATACTGCGGCTTTCCAAACCACGTGAGCGGCAACATCAAAACCGATGAAATCCACATCATACCCTCCTTGG ACAAGAACGCCATAGCCCAGGCCTTTTGGAAGAACGTGGAAAGCGATTTCGACCTCAGAAGAATAAAGGACGAGATCGAA ATAGTCGGCATAGAGGGCCACTACGCCCCCTACTGGATCGGTCTGGTTCACGTCTACGGAACGGTCCGCTACATGAGGCG TGAGGAAGAGTGCCACACGGACTCAAAGGGAAACACCCGCTGTCACACGGTGGAGAGACACTACACCGAG