tg0752

Coordinates:712440-713126

>tg0752 hypothetical protein TGAM_0752
MRKVVGVLLLIGLIATVCVFFTHSAHYGKKNNPIDFRPVYLSNVSLNARFSNEGPGILVVQYSDIEKAPINLSKPVLVVG
EINVTRLLITFNITTPLASIEPSPKAVFVYNRGLLFLESGDVRKFLVWTREVIRYEAHWSFGIYSEHSGILLAVRSSHIE
PPKNWSSVGGTLPEYFVSVEITVPGNENVELSLVPLNGKLSNYHPTTSKGQTSPSTTGRAFSGTPRRGQ

>tg0752 hypothetical protein TGAM_0752
atgagaaaagttgtgggggttcttttactaatcggattgattgcgacagtttgcgtgttcttcacccacagtgctcatta
cgggaagaaaaataatcccatagatttcaggccagtttacctttccaacgtttccctaaacgccagattctcaaacgagg
ggccggggattctcgttgtccagtactctgacattgaaaaggcaccgattaacttgagcaagccggttcttgtggttgga
gagatcaacgtcacacggctcttaattaccttcaacataacgacaccgcttgcttccattgaaccttcccccaaggccgt
ctttgtgtacaacagagggttacttttcctcgaatctggagatgtgaggaagttccttgtctggactcgcgaagtcatac
gatatgaagcccactggagctttggaatttactctgaacactcgggaatcctgctggccgttagatcatctcacattgag
ccacctaagaactggagctccgttggaggcacccttccagagtacttcgtttctgtggagataactgttcccgggaacga
gaacgttgagctctcccttgtccccctgaatgggaaactatccaattaccatccaacaacatctaaggggcagacttcac
catccacgacaggtcgagctttttcaggaacaccgcggcgtggacag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 711940 - 713626 (Additional range around tg0752 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGGGAATAGACTGGCGCTTTGAAACGAGCCTGGACGGTCACGTAAGGCTTCCAGCGGCCCAGCAACTGACCCTCCCTGA GTGGCAGTTCGAACCCGAATACACCGTAACGGGCCATGCATCCTCAACGCTCCGCGAGTCCCTCCTTGAGAAGGTCTTCG ATATGGCCGAGAAGTACGTGAAGGCGACGCAGGAGTACTACTCTCCAGGCATAATCGGGCCCTTCACGCTCCAGACGGCG GTTGACAAGGACCTGAACTTCTACATCTACGACGTCGCCCCGAGAACCGGCGGCGGGACGAACATCCATATGGCGATGGG TCACCCCTACGGAAACGCCCTCTGGAGAAAGCCGATGAGCACGGGAAGGAGGGTTGCCCTCGAGATAAAGCGCGCAATCG AGCTCGACGAGCTTGAGAGGGTGGTGACTTAATCACAGTTTTAATCTTTTAAGACGAAACATTTTTAACTTACAATGCGT AAAGAAGTAGGGCAATTTCA atgagaaaagttgtgggggttcttttactaatcggattgattgcgacagtttgcgtgtt cttcacccacagtgctcattacgggaagaaaaataatcccatagatttcaggccagtttacctttccaacgtttccctaa acgccagattctcaaacgaggggccggggattctcgttgtccagtactctgacattgaaaaggcaccgattaacttgagc aagccggttcttgtggttggagagatcaacgtcacacggctcttaattaccttcaacataacgacaccgcttgcttccat tgaaccttcccccaaggccgtctttgtgtacaacagagggttacttttcctcgaatctggagatgtgaggaagttccttg tctggactcgcgaagtcatacgatatgaagcccactggagctttggaatttactctgaacactcgggaatcctgctggcc gttagatcatctcacattgagccacctaagaactggagctccgttggaggcacccttccagagtacttcgtttctgtgga gataactgttcccgggaacgagaacgttgagctctcccttgtccccctgaatgggaaactatccaattaccatccaacaa catctaaggggcagacttcaccatccacgacaggtcgagctttttcaggaacaccgcggcgtggacag TGAAAAACAAC GGAGATCATGACGTCCAGCTCAGTGCAACCATTGGTGCCGAGTCTCCCCAACTAACTCTCCAGTACTTCCTCAACTATGT AGAGGGCTCTCTGCACGTTCGGATGGGCCCATGACCTCTTAGAAAATTTTTTATTCTTTGCCAGATAATCCCTCATCTCT TTCTGTTCAGCTTATTAAAGCCGCATCTCATTCGGGAAACGTTTTTAAGAGAGGAAGAGCCGCTTTTCCTGTCGATCAAC GATCTGGGGGTTGAAACCATGGATAACCGCTGGAGAACGGTCATTCTTAACACCCTCGTTGTTGCCTCAGGTTTCGGAAC GATGCACATGCTGGAGAAGTTTAAGGATGCAGTTGTGAATCACTACGGGATCACCGAGACAATGATGGGCTACCAGCAGA CAGCCTACGTCGTTGGCCTCTTCGTTGCTTTCCTCCTCGGCGGAACGACCCTCTTCAAGGGTTCCTTCAAGAGGAGTGTG GCTTTAAT