tg0755

Coordinates:714919-715587

>tg0755 Phosphoribosylformylglycinamidine synthase I, purQ component (purQ)
MVRFAVVVFPGTNCDFETERAIRKAGAEAERVWYRASLKDFDGVVLPGGFSYADYLRAGAIAARQKIMEEVKEFAEEGRP
VLGICNGFQILTEAGLLPGALRPNRVPRFLCRWVHLRVNDVETPFTSLYEPGEVIRMPIAHAEGNYYIDDPSKVRIVFQY
SDENGNVSEEVNPNGSVLNIAAIANERGNVLGTMPHPERASDRFLGSEDGLRLFKSMVEWARR

>tg0755 Phosphoribosylformylglycinamidine synthase I, purQ component (purQ)
atggtgcgctttgccgttgtggtcttccctggaaccaactgcgacttcgagactgagagggccataaggaaggccggcgc
cgaggccgagcgcgtctggtacagagccagtctcaaggacttcgacggcgtggttttgcctggcggcttcagctacgccg
actacctaagggcaggtgcgatagccgcccgtcagaagataatggaggaggttaaggagtttgccgaggagggacggccg
gttctcgggatatgcaacggctttcaaatcctcaccgaggcgggcctccttccaggggcgttgaggcccaacagggttcc
gcgcttcctctgcaggtgggttcacctccgcgtaaacgatgtggaaacgccgttcacttccctctacgagccgggtgagg
taataaggatgccgattgcccacgcggagggcaactactacattgacgacccgtcgaaggttagaatcgtcttccagtac
agcgacgagaacgggaatgtgagcgaagaagtcaatcccaacggctcggttctcaacatagcggcgatagccaacgaacg
tggaaacgttctcggaacgatgccgcacccggagcgtgcgagtgatcgctttttaggcagtgaggacggcctgaggctgt
tcaaaagcatggttgagtgggcgaggagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 714419 - 716087 (Additional range around tg0755 is :500nt.)

>Thermococcus gammatolerans EJ3 GCCCTCGGACTCATCTCGAACTCCGCCAACGCCGTCGCTCCGAACGTCATGTTCGTCCTCGTGCACAGCGTGAACACTGG GATGGTAATCTACCTGCTCATGGCTGCCCTCGGCATTGCCACCCTTCTCCTCTCGAGCCGCATGAAGCTCCCGGTCGAAG AACTCTCGGGATGAAATCTTTCTTTTTTGCATTTTCTTGTTAAAATAACTCTTAAAAACTCCCAATTTTTACATTTTTCT GGCAAGGGTGGTCGCGATGAAGTGGAGGGTTACCGTCACCGTTCGCCTCAAGGAAGGCCTCAACGACCCCGAGGGAAGGG TCATAGGGAAGGCACTCAGAAACCTCGGCTACGCGGTTGATGGCCTGAGAGTTCCGAAGTGCTTCGAGTTCGAGCTTGAG AGCGAGAGGCCGGAGGAAGAGGTAGAGGAGATGTGCAGGAAGCTCCTCGCCAACCCGCTCATCCACAGCTGGGAGTATAG GATAGAGCCGGTGAGCTGAG atggtgcgctttgccgttgtggtcttccctggaaccaactgcgacttcgagactgagag ggccataaggaaggccggcgccgaggccgagcgcgtctggtacagagccagtctcaaggacttcgacggcgtggttttgc ctggcggcttcagctacgccgactacctaagggcaggtgcgatagccgcccgtcagaagataatggaggaggttaaggag tttgccgaggagggacggccggttctcgggatatgcaacggctttcaaatcctcaccgaggcgggcctccttccaggggc gttgaggcccaacagggttccgcgcttcctctgcaggtgggttcacctccgcgtaaacgatgtggaaacgccgttcactt ccctctacgagccgggtgaggtaataaggatgccgattgcccacgcggagggcaactactacattgacgacccgtcgaag gttagaatcgtcttccagtacagcgacgagaacgggaatgtgagcgaagaagtcaatcccaacggctcggttctcaacat agcggcgatagccaacgaacgtggaaacgttctcggaacgatgccgcacccggagcgtgcgagtgatcgctttttaggca gtgaggacggcctgaggctgttcaaaagcatggttgagtgggcgaggagg TGAGGAAATGTTCCCGCACGAGGAGAAGC TCATCCGCGAAAGGCTCGGCAGGGAGCCGAACGAACTTGAGTGGGCGATGCTCGAAGTGATGTGGAGCGAGCACGCATCG TACAAATCCAGCAGGCCCTGGCTCAAGCTCCTCCCAACGGAGAACGAGCATGTGATTTTGGGCCCGGGTGAAGATGCTGG AATAGTGAAGTTCGACGACGAGACGTGGGTAGTCGTTGGAATCGAGAGCCACAACCATCCAAGCGCGGTCGAGCCCTACG GGGGAGCGGCCACTGGAGTCGGGGGAATTGTGAGGGACATACTCTGCATGGGCGCGAGACCAATAGCGCTTCTCGATCCC ATACGCTTCGGCCCGCTGGAGAAGGAGAGAAACCGATACCTCTTCGAGTATGTCGTTAAGGGTATAGCCGACTACGGCAA CAGGATAGGCGTTCCGACCGTTGGGGGCGAGACGGAGTTCGACGAGAGCCTCGACAGCTACACGCTCGTT