tg0763

Coordinates:723006-723569

>tg0763 GMP synthase - glutamine amidotransferase subunit (N terminal domain) (guaA_N)
MIVIMDNGGQYVHRIWRTLRYLGVEAKIIPNTTPLEEIKAMEPKGIIFSGGPDINKTGNCDAILEHYDEFNVPILGICLG
HQLIARHFGGKVGRGKKAEYSLVEIEIVEENDLFKGFPRKLKVWESHMDEVKELPPGFKLLARSETCPIEAMKHETLPIY
GVQFHPEVSHTERGAEVYRNFARLCGEL

>tg0763 GMP synthase - glutamine amidotransferase subunit (N terminal domain) (guaA_N)
atgatagttataatggacaacggcggacagtacgtccacaggatttggagaacgctccgctatctgggcgtcgaggcgaa
gataattccgaacacaaccccgcttgaggaaatcaaggcgatggagccgaagggaataatcttctcaggtggccccgaca
taaacaagacgggcaactgcgatgccattctagagcactacgacgagttcaacgtcccaatcctcgggatctgtctcggt
caccaactcatagcgaggcacttcggtggaaaggtcggtaggggcaagaaggccgagtacagcttggttgagattgaaat
agtcgaggaaaacgacctctttaagggctttccaaggaagctgaaggtgtgggagagccacatggatgaggtgaaggagc
tcccgccgggctttaaactgctcgcgaggagcgagacctgtccgattgaggccatgaagcacgaaacgctcccaatctac
ggcgtccagttccatcccgaggtctcccacaccgagcgcggggccgaggtttacaggaacttcgcgaggctctgcgggga
gctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 722506 - 724069 (Additional range around tg0763 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAAAAGTTCAGGGAAGACCCGACGGACTATCTCCTTCGCTTGAGGGAGGAGGAAACATGAAGGTCGTGGTTGACACCTC CGTTGTTTTCCATCTGTTTTCTAGCTTCTATCCTGAAAGGGCAGAAGTCGCCGAAAGAATCATAGAGTATGCACAGTTAG GCTCGCTTGAGCTTTACGCTCCCCGCTTGGGGGAAGTTGAGTTCGTTGCTGTTCTCTCAAGGTATTTTGAGCGGGAGCAG GTTGAGAAGGCGCTAACCTACTACAGCGAAATAGTTGCGTGGGTTCCTGAGGAACTGCTCATCGAGGAGCTTCGAGAAGT GGCCTTTCAGACGCATCACAAGGCTTCTGATATCTATTTCATTGCGACAGCCCGATACCTTGACGGGGTTCTTGTTACGA ATGACAGGAAGATGGCCGAGCTGGCCAAGTCCCTTGGTTTGAGGGCTTTTTATCTCGTTGAAGAACACGATGCCTTCTTC AAACTCCTGGAGGTGGGCTC atgatagttataatggacaacggcggacagtacgtccacaggatttggagaacgctccg ctatctgggcgtcgaggcgaagataattccgaacacaaccccgcttgaggaaatcaaggcgatggagccgaagggaataa tcttctcaggtggccccgacataaacaagacgggcaactgcgatgccattctagagcactacgacgagttcaacgtccca atcctcgggatctgtctcggtcaccaactcatagcgaggcacttcggtggaaaggtcggtaggggcaagaaggccgagta cagcttggttgagattgaaatagtcgaggaaaacgacctctttaagggctttccaaggaagctgaaggtgtgggagagcc acatggatgaggtgaaggagctcccgccgggctttaaactgctcgcgaggagcgagacctgtccgattgaggccatgaag cacgaaacgctcccaatctacggcgtccagttccatcccgaggtctcccacaccgagcgcggggccgaggtttacaggaa cttcgcgaggctctgcggggagctc TAGCTCAGCTAGTCGGTCCTCTCTTCACCTTTCCGCAACGGATTTACTCATCAT CGCATCCACTACTTTTAGGGAAAAACTTTTTAAGGTTTGCTTGTTACTATTTTTGGTGATATCTTGGGACATACGATCTA CTATAAAACTTCAATCCATCGGTGGGAAGAGTTTCTGAGTTTCATTGGTAGAGTTTGTCAGGGGCTGGGCTATGAAGTGG CACCTGTGGGGGAGTCCGTCAGTGTATTTCCCACCTGTTCGCTAGTGGAGCCCCTCCTCATTCCGCGAAGTGGGGAGGGC TTCGTAAAAACTAACCTTATTGAACCCTGCCACTCAATTTATCTCCTTATCCTTCACTCGGTGTCGTCCTTTGGCTCGGT CTCGGTGTGGGAGGATTGATCTAGGTAGACCTCGATTACTCTGACCGGCACCGAACCTTTCAAAGTTCTCTCCTCCACCA GTAGCTTCACGACCCTGCCCGGCTCGGCATCAGGAACGGCGGGAA