tg0764

Coordinates:723687-723959

>tg0764 Putative TonB-dependent receptor
MGHTIYYKTSIHRWEEFLSFIGRVCQGLGYEVAPVGESVSVFPTCSLVEPLLIPRSGEGFVKTNLIEPCHSIYLLILHSV
SSFGSVSVWED

>tg0764 Putative TonB-dependent receptor
ttgggacatacgatctactataaaacttcaatccatcggtgggaagagtttctgagtttcattggtagagtttgtcaggg
gctgggctatgaagtggcacctgtgggggagtccgtcagtgtatttcccacctgttcgctagtggagcccctcctcattc
cgcgaagtggggagggcttcgtaaaaactaaccttattgaaccctgccactcaatttatctccttatccttcactcggtg
tcgtcctttggctcggtctcggtgtgggaggat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 723187 - 724459 (Additional range around tg0764 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGCCATTCTAGAGCACTACGACGAGTTCAACGTCCCAATCCTCGGGATCTGTCTCGGTCACCAACTCATAGCGAGGCAC TTCGGTGGAAAGGTCGGTAGGGGCAAGAAGGCCGAGTACAGCTTGGTTGAGATTGAAATAGTCGAGGAAAACGACCTCTT TAAGGGCTTTCCAAGGAAGCTGAAGGTGTGGGAGAGCCACATGGATGAGGTGAAGGAGCTCCCGCCGGGCTTTAAACTGC TCGCGAGGAGCGAGACCTGTCCGATTGAGGCCATGAAGCACGAAACGCTCCCAATCTACGGCGTCCAGTTCCATCCCGAG GTCTCCCACACCGAGCGCGGGGCCGAGGTTTACAGGAACTTCGCGAGGCTCTGCGGGGAGCTCTAGCTCAGCTAGTCGGT CCTCTCTTCACCTTTCCGCAACGGATTTACTCATCATCGCATCCACTACTTTTAGGGAAAAACTTTTTAAGGTTTGCTTG TTACTATTTTTGGTGATATC ttgggacatacgatctactataaaacttcaatccatcggtgggaagagtttctgagttt cattggtagagtttgtcaggggctgggctatgaagtggcacctgtgggggagtccgtcagtgtatttcccacctgttcgc tagtggagcccctcctcattccgcgaagtggggagggcttcgtaaaaactaaccttattgaaccctgccactcaatttat ctccttatccttcactcggtgtcgtcctttggctcggtctcggtgtgggaggat TGATCTAGGTAGACCTCGATTACTC TGACCGGCACCGAACCTTTCAAAGTTCTCTCCTCCACCAGTAGCTTCACGACCCTGCCCGGCTCGGCATCAGGAACGGCG GGAACCCAGTACCGTCCCGGCTTGACGTTTGCAGCTAAATCATCGTTCACGAAGACCCTTATGAGGTCACCTCTTACCTC TTCGACGATCCCGTAGGTGTATTCCCTTCCGTACCGCCCCTTAAAGTACCATCTGAAGAGCAGAACCACTATCAGAACGC CTATGAGGTAGCCATAGTAGTAGTAAACGCTCGTTGCAAGCTTTCTCAGGAGGAGGTATCCCAGAAAGGAGAGAAACGAT ATCACTGAAATCACGCTGTAAAAGAAGTAGTACGGCTCGGCCTCAACGAAAAAGTTCCAGTTCCTTTTTATCAGGTACCT TAGGTAGGCTATCTCTCCAATAAACAGAAGGGCAAGGAGATAAGGACTTCTTAAGGTCAGGACTATCAGGAGGG