tg0772

Coordinates:731777-732400

>tg0772 hypothetical protein TGAM_0772
MPSEGIRDSVEVALELDEREVYSHIAHESAEDIRRIISSIDAERAQKKGFLVYYHDDWDSLIRERIRKGKRHTAFDFYNP
ALLDIWEAKVEELKDVRKAKYFLLSLIGIGVIFSITAGLLFSWYFVLPGLGLLPLVLWVLDRAREKSDLIYHQLTQFFID
EMRALLSRYNLNPERYRFKLFNDDYFGVRRIKIGRESFAIAEPLNDVE

>tg0772 hypothetical protein TGAM_0772
atgccgagtgaggggataagggattcggtagaagtcgcgctggagctcgatgagcgggaggtatactcccacatagccca
cgagagcgcggaggacataaggcggataatttcatcaatagacgcggagagggcccagaagaagggcttcctcgtatatt
accatgacgattgggacagcctgataagggaacgcatcagaaaaggaaagaggcataccgccttcgatttctacaaccca
gcccttctagacatatgggaggccaaggtcgaggagctcaaggacgtcagaaaagccaagtacttcctcctttcacttat
aggtatcggcgttatcttttcaatcaccgccggactgctcttctcgtggtacttcgtcctcccagggctgggactactgc
ccttggtgctctgggtcttagatcgagccagggagaagagcgacctcatctaccatcagctgacccagttcttcatcgat
gagatgagggcccttctgagcagatacaacctcaacccggagaggtacaggttcaaactgttcaacgacgattatttcgg
tgtcaggaggattaaaatcggaagggaatcctttgccattgccgaacccctcaatgatgtggaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 731277 - 732900 (Additional range around tg0772 is :500nt.)

>Thermococcus gammatolerans EJ3 GTTCCTGGGGAGCAGACCCTCGACGCAAGCGATCTGAAGTTCGTCCTCAAAGCCTTTGGAAGTTTTGCAACAGTCGGCTA CGCGAAGGCCCGGGCGGATCAGCTCAAGAGCCTCTCGAAGCTGATAGTCAGGTCGTTCGAGAGTGAGGGGCTTTATCTCG AGGCCAACGTTGAGTCAGCCCTTTACGGTCTCGTAGCAGTTCACGGCCCACCCGAAGTCCTCAAGGCGAAGGAGATCTTC GAGGCCCTTGACGAGCTCACAGACAGAATCAAAGGAAAACAGATCTTCAGGGGCTTTTATCCTGATCCAAGAACGCGCGA GGTTGAGGTTGTAACGCTTCTCAGTGGCATCTACGAGAGCGAGAGCATAGAAAGAATCATCAGAACCGCCAAGGAGTACG CAAGCTCGTTTATGAGGGCAAAGAAAGAAGCAGAGGAGAAGAAGAGGGAACTGCTTTCAGGCCTTCCTGATTTCGATGAT CTCTACCCCGGTGGTGAGA atgccgagtgaggggataagggattcggtagaagtcgcgctggagctcgatgagcgggag gtatactcccacatagcccacgagagcgcggaggacataaggcggataatttcatcaatagacgcggagagggcccagaa gaagggcttcctcgtatattaccatgacgattgggacagcctgataagggaacgcatcagaaaaggaaagaggcataccg ccttcgatttctacaacccagcccttctagacatatgggaggccaaggtcgaggagctcaaggacgtcagaaaagccaag tacttcctcctttcacttataggtatcggcgttatcttttcaatcaccgccggactgctcttctcgtggtacttcgtcct cccagggctgggactactgcccttggtgctctgggtcttagatcgagccagggagaagagcgacctcatctaccatcagc tgacccagttcttcatcgatgagatgagggcccttctgagcagatacaacctcaacccggagaggtacaggttcaaactg ttcaacgacgattatttcggtgtcaggaggattaaaatcggaagggaatcctttgccattgccgaacccctcaatgatgt ggaa TGACCCCATATTTTTGTTGAGCAAGCGTTAAATAGGCAAAATCCATAACATACTCAGAGTGAGGGCTATGGGCAA GAAGGGTCAGATCTCCCTCGAATTCCTGTTCATCTTCGCAATCCTGCTCATCCTGTTAGCTTACTCAGTCAAAAACACGA CGTTCCAGCAGGGTTCCCAGTCAATCGAAACACTAAGGGTACAGATAGCCCTTGAAGAGAAGGAGCTGGCCAACACCATA TCCGGAGCCATAAGCCAGGCGTACTCCCAGGGACCGGGCTCGAAGACGACCGTTTACGTAAAGCTCGTGTACCTTAGAAA GCCGTACTACCTAGAGAAAGTGTGGGGCGTTGCAGATCCCATGATCTTCGTAACCTATGGCCAGCATCTAAACGATGGGA ACGGAACGTACGTGATGGTCCTCAACGGCACCGGAACAACGAAAGTCATCCTGACGGGGGGAAACAAGAACGCCTTCTGG ACTAGGGCGCTCTACCAGAGGGATC