tg0781

Coordinates:739505-740149

>tg0781 Zinc-dependent protease, putative
MEVEVRHRPVRYARLEIKPDGRIVVTAPEGFDVEAFIKKHERWLRNRLRELEEVRRESARGFPFFGEFYRLELGNVRKVE
LRDGKLILPAERERARKALKELLRDKVAALVTLYSVLMGVSPGKIYIRNQRTKWASCSSRGNLSFNLRLAALPEKLIEYV
VIHELAHLRYLDHSRAFWRFVGRFYPDYGTARRELRRWWGVIEVNEGWRWLEGRE

>tg0781 Zinc-dependent protease, putative
atggaggttgaggttcggcaccggcctgtccgctatgcgaggctcgaaatcaaacccgacgggagaatcgtcgtgacggc
gccggaaggctttgatgtggaggcgttcatcaaaaagcacgaaaggtggctgagaaaccggctgagggagcttgaggagg
taaggagggaatctgcgaggggcttcccgttcttcggcgagttctacaggcttgagctggggaacgttcggaaagttgag
ctcagggacggcaagctaatcctcccggccgagcgcgagcgggcgcggaaggctctgaaggagctcctgcgggacaaggt
agcagctctcgtcaccctctactccgtcctgatgggcgtctccccgggcaaaatatacatcaggaaccagagaacgaagt
gggcgagctgctcaagcaggggaaacctgagcttcaacctccgtctcgcggctttgcccgagaaacttatcgaatacgtc
gtgatccacgagctcgcccacctgcgctacctcgaccattccagggctttctggaggttcgtgggacggttttatccgga
ctatggaaccgctaggagggagctgaggcgctggtggggagtaattgaggtcaacgaggggtggagatggctggagggaa
gggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 739005 - 740649 (Additional range around tg0781 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTTCATAACCGGTGTCAAGGGTTCCAGGAGGGACTTTTCCCGGCCGTCGAAGGAGTTGAGGGTTAAGCCGACCTCAATC GAGCGGAAGAGCTTGAAAAGGGCAATATCCCTCGTAACTAGGGGCGATTTGGTAAGGATTGAAAGCTCGTTCCTCTTGTC CATGAACCGGAGCGTCGCTCTGGTAAGCTTAAGTTTGGCCTCAACAGGCTGGTAGGGGTCACTTACTGTGGACATCACGA TTTTCCCGGAAACGTGCTTTCTCGCTAGCTCGGGCGCGTTGATTTTGGCTATCACCCAGCTCCCCCATTCTCTCTCCCCA AACTCCCGGACTACGTTTTTGGCGTAGCAGTATGGACAGGCGAAGGAACAGCCGACGTACTGGTTGGCGCTCCACGAAAC GCCGGGAATTCGCGAACGGGTGTAGAGGGATTTGGCCCTCCGCTTTATGACCTCAACCTTCATAAGCACGGGTAGGGACT ACACCTTAAAAGGTGGTCGC atggaggttgaggttcggcaccggcctgtccgctatgcgaggctcgaaatcaaacccga cgggagaatcgtcgtgacggcgccggaaggctttgatgtggaggcgttcatcaaaaagcacgaaaggtggctgagaaacc ggctgagggagcttgaggaggtaaggagggaatctgcgaggggcttcccgttcttcggcgagttctacaggcttgagctg gggaacgttcggaaagttgagctcagggacggcaagctaatcctcccggccgagcgcgagcgggcgcggaaggctctgaa ggagctcctgcgggacaaggtagcagctctcgtcaccctctactccgtcctgatgggcgtctccccgggcaaaatataca tcaggaaccagagaacgaagtgggcgagctgctcaagcaggggaaacctgagcttcaacctccgtctcgcggctttgccc gagaaacttatcgaatacgtcgtgatccacgagctcgcccacctgcgctacctcgaccattccagggctttctggaggtt cgtgggacggttttatccggactatggaaccgctaggagggagctgaggcgctggtggggagtaattgaggtcaacgagg ggtggagatggctggagggaagggag TAAGTCTGCTCAAGCTCATCGCGCTGATTGCAGACGAGATAATCGTTGGTGTT TTCCTTCTCGTTGTTCTTCCAGCCCTTGGAATGGGGGTACCGGTTTTGGTCACGGGGCTGGTTCTGGGAGTCCTCCTCGT CAAGGACGTTCTGATAGCCCCGTACGTGCTCGGAGGCGGGCTCGAAAAACGGCCCAAGGCCGGGCCAGAATCTCTCGTCG GCAGAACCGCTGTGGTCGTGGATGACCTCTCGCCGGAAGGCCTCGTGAAGCTCGACGGCGAGCTCTGGCGGGCAAGATGC TTTCACGGAACCGCGAGGAGGGGAGAAAAGGTTAGGGTTGTTGAAGTTGATGGAACTAAGCTCCTCGTTGAACTCCCAGC GAGCGAAGAACCTCGATAATTTCCTCCGGCCTGTTGGTCGAGAAGGAGACGTCCCAGCCCTTCTTTCGCTTGATGTAGAC GCAGGCCTTTGCAGGAAGGGTGAAGTGAATCTTCGCCGGACAGCTC