tg0790

Coordinates:744847-745269

>tg0790 hypothetical protein TGAM_0790
MLLSFEVSTTERFQIIDVTDEVQRLVWKGKLRHGIAVVFTKHTTTGLMINEPEKGLLEDIKAKMKELIPRGAGYKHDRID
SNAHSHLRASLFLNTELVVPVDEGELVLGTWQRILFVELDGPRHRKIMVMLCPCPEYPEEE

>tg0790 hypothetical protein TGAM_0790
atgttgctgagttttgaagtgtccacgactgaaaggtttcagatcattgacgtgaccgacgaggttcagcggctcgtgtg
gaaggggaagctgaggcacggcatagctgttgtttttacaaagcatacgacaaccggcctgatgataaacgagccggaaa
aaggacttcttgaggacatcaaggccaagatgaaggaactaattccgaggggtgccggttacaaacatgacaggattgac
agcaacgcccactcccacctcagggcaagcctgttcctgaacaccgaactagtcgttcccgttgatgagggcgagctggt
tctcggcacgtggcagagaatactcttcgttgagctcgatgggccgagacaccggaagatcatggttatgctctgtccct
gtcctgagtatccggaggaggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 744347 - 745769 (Additional range around tg0790 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCGCTCGATAGTCTTGGCAGATATAGCCCACAGGTTACTCAAGATGGGGGACGTTTCAAGGGCTATTGACGTTGCCCTT GAAGTTAGGGATCCGAAGTTCTCTTCCATTCTGATAGCTGAAATCCTGATCGGAGCCCTTGACAGGGAGATAGAGGCCAA GGTGATAGTCAATGGAAAGGCTAAGAATCACTCTTAGACGAAAGAAGAGCGATCCCGTTGATTATGCAAGGGACCTTGCG GAGGCCCTGCTTGAGGGCAGGGTTATTGGGGAGGACGTTCTCTTCAGGGACGCGGTGAACGAGATCTACACCACCCTGAA GGAGGCTCTCTTCAAGGGAAAGGAGGGAAACGAGAACCTGATCCAGGCCTATGAGCTCGCCGTCGTACTCCGCTACCTTG TACAGGATGGCGTTAAGACCTCAAGGGAGATACTTGAGGAACTCGTTCAGATCCTCGAATGAGTTTTAAGCTCTTTTTCC AACTTTCCCCGGTGGTCCCG atgttgctgagttttgaagtgtccacgactgaaaggtttcagatcattgacgtgaccga cgaggttcagcggctcgtgtggaaggggaagctgaggcacggcatagctgttgtttttacaaagcatacgacaaccggcc tgatgataaacgagccggaaaaaggacttcttgaggacatcaaggccaagatgaaggaactaattccgaggggtgccggt tacaaacatgacaggattgacagcaacgcccactcccacctcagggcaagcctgttcctgaacaccgaactagtcgttcc cgttgatgagggcgagctggttctcggcacgtggcagagaatactcttcgttgagctcgatgggccgagacaccggaaga tcatggttatgctctgtccctgtcctgagtatccggaggaggag TGAAATGAGGGCGTTTATCTCGGTTGACCTGGAGG GCCTTCCCCATGTCGTCAGCAGGGAGCACCTCTTCGTTAAGGGGGCCCTGTACAGCGAGGCCCGGAGGATAGCGACTGAA GTCGTCAAAACCGCGGCCGAGGCCTTATACCAGAACGGTTTTGACGAGGTTGTGGTGGCTGACAGTCACGGCCCCATGGT GAACGTCATCCCGGAGGAGATGCCGGACTACGTGGAGCTCGTGAGGGGCTTTCCTAGGCCCCTGAGCATGGTCGCCTTCG CGAAGGGAAGCGATGCGGCAATTTTTCTCGGCTACCACGCTAAGGCGGGAACAGGCTACGCAACCTTCGACCATACATAC AGCGGCTCGACCATTGATCGGCTCGAGATAAACGGAATCGAGGTCAGCGAGTTCCTCCTCAACGCGTACCTCCTCGGTAG CTGGGGGGTTCCAGTGATACTTGTCGGTGGGGACGCGAGGCTCATAGAGGATGTCAAAAAGTTT