tg0803

Coordinates:758920-759066

>tg0803 DNA-directed RNA polymerase subunit P (rpoP)
MVKAIYRCAKCGREVELDLETAREVRCPYCGSKILYKPRPRVARRVKAI

>tg0803 DNA-directed RNA polymerase subunit P (rpoP)
atggtcaaggccatataccgctgcgccaagtgcggccgggaagttgagctcgatctcgaaacggcgagggaagtccgctg
cccgtactgcgggagcaagatactctacaaaccccgcccgagggtagccagaagggtcaaggccatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 758420 - 759566 (Additional range around tg0803 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGAGGACGTCGGCGACTTTCATTCCCCTTTTCCACTCGACTTCTTTTTCAATTCCCCTTCCAAGGACTTTCACCCTGAT CATCCGGCTCACCCGCCCTTCCTGCTCTGGAGTGTTTATAAATCCAGTGGCGGTTTCGGATCATGCAAAGGTTTATAAAA CGTCCCCTAAAAAACCCAACAGTCTCAGGAGTGGAGTTAATCAGGGGTGATGCTCATGGGAAGGACTGTTAAAGTTGGTT CGGCTGGAAGGTTCGGTCCAAGGTACGGTCTCAAGATCAGAAGGAGAGTAGCCGCCGTTGAAGCCAGGATGAAGCAGAAG CACGTCTGCCCGGTCTGCGGAAGGAAGGCCGTCAGGAGAATCAGTACGGGCATATGGCAGTGCCAGAAGTGCGGGGCAAC TTTCGCCGGCGGTGCCTACCTGCCGACCACCCCTGCCGGAAAGGTCGCGAAGCGCGTTGTCGCTTCCAAGGCCTGATTCT CCCATTTTGGGGTGATATT atggtcaaggccatataccgctgcgccaagtgcggccgggaagttgagctcgatctcgaa acggcgagggaagtccgctgcccgtactgcgggagcaagatactctacaaaccccgcccgagggtagccagaagggtcaa ggccatc TAAAGCTCGATCTCGAGCTCTGGCTTTTCTAAAATCACTCTCCCGTCCGGAATAAGAGAAATCGAGAGTCCC TCGATTCTAACCCCTGCCCTCTTTGCCTCTCTCAAAAGCCTCGCGAGTTCCGGGTCGCCCTTCTCGTAGGGCCGGAACTT CTCAACCTTTGGCATCGCACCGATGAAAAAGATTATCGCGTCCTTTCCGGCTTTGACGAGCTCAATCAGCTCTCTAACGT GCCTCTGCCCGCGCAAAGTTGGGCAGTCAGGATACATCGCGTATTCACCTTTCTTCCCTCCCCTAAGAACGGCGCTTTTC ATCTCGCCGTAGAGCTCTCCACCGGGACACTCGAAGAGGTAGTCGAGGCGAGAATTGCCGAGGCGAACTTCCTTCCGCTT TATCGAGCAGTTCTTCAGCCAGGGGACTAAACCAAGCTCAACCGCCCTTTCAAAGGCCTTCGCCTGGGTTCTCGTGTCCA CTATCGCTCCCTTGCCTTCTAAATCCTC