tg0805

Coordinates:759474-759683

>tg0805 Sulphur transfer protein, ThiS family (ThiS)
MSRMIRVKVLGRGIEKEVEWKRGMKVADVLREVGFNTESAIARVNGKVVLEDDPVGDGDYVEVIPVVSGG

>tg0805 Sulphur transfer protein, ThiS family (ThiS)
gtgagccggatgatcagggtgaaagtccttggaaggggaattgaaaaagaagtcgagtggaaaaggggaatgaaagtcgc
cgacgtcctcagggaggttggcttcaacacggagagcgcgatagcgagggtaaacggaaaggtggtccttgaggacgatc
ccgttggggatggggactacgtggaggtcattcccgtcgtttcaggtggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 758974 - 760183 (Additional range around tg0805 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCGCAGTACGGGCAGCGGACTTCCCTCGCCGTTTCGAGATCGAGCTCAACTTCCCGGCCGCACTTGGCGCAGCGGTATA TGGCCTTGACCATAATATCACCCCAAAATGGGAGAATCAGGCCTTGGAAGCGACAACGCGCTTCGCGACCTTTCCGGCAG GGGTGGTCGGCAGGTAGGCACCGCCGGCGAAAGTTGCCCCGCACTTCTGGCACTGCCATATGCCCGTACTGATTCTCCTG ACGGCCTTCCTTCCGCAGACCGGGCAGACGTGCTTCTGCTTCATCCTGGCTTCAACGGCGGCTACTCTCCTTCTGATCTT GAGACCGTACCTTGGACCGAACCTTCCAGCCGAACCAACTTTAACAGTCCTTCCCATGAGCATCACCCCTGATTAACTCC ACTCCTGAGACTGTTGGGTTTTTTAGGGGACGTTTTATAAACCTTTGCATGATCCGAAACCGCCACTGGATTTATAAACA CTCCAGAGCAGGAAGGGCGG gtgagccggatgatcagggtgaaagtccttggaaggggaattgaaaaagaagtcgagtg gaaaaggggaatgaaagtcgccgacgtcctcagggaggttggcttcaacacggagagcgcgatagcgagggtaaacggaa aggtggtccttgaggacgatcccgttggggatggggactacgtggaggtcattcccgtcgtttcaggtggc TGATCGAC GAGTTTCAGAGAAGGATCTGCCTTTTGGACGGCGACGTTTTCAGCGTTTCGACAAAAGTTTTATTAAATGCTGCTGGATA ACGGGGATCATGATGATCTTTGTATTCCTTATCGCGGGCCTTTTGTTCGGTTATTTCCTCAGGAAAGCTGGAAAACGACC GAGCATGGAAACACCTATGAGTGTTGCGTTGCTCGCTATGATATTTTTCCTCGGAGTTAAAACTGGTGAGGTTCATGTGA ACGGTCTCTGGCTCCTCGGCGTTTCTGCGGTTTTTGCAGTTCTGACGATAGCTGGAAGCCTTTTCTTGGCGGAGGTGGTC GGGTGATGTTTCTTTACCTCGTTCTCGCGTCGCTTGTTGCGGGGATCCTTGTGGGGCACCTCTTCACTCCAGACTTCGGG AACGCCTACGAGATAATGCTCTACGCCCTCATATTCCTGATTGGAGTGGATCTTGGCTTGAGCTTCAGCACTGGAGAGCT CAGAAAGGTTG