tg0807

Coordinates:760014-760601

>tg0807 Membrane protein, DUF340 family, putative
MMFLYLVLASLVAGILVGHLFTPDFGNAYEIMLYALIFLIGVDLGLSFSTGELRKVGRKALLLPFLTLTGSILGGLLAAL
VLGIEMRWGLAIGAGCGWYSLTGPLIAQYSAVYGAVGFLGNLLREILTITLYPLAIRKLNPEKAIVIGGATTMDTTLPIM
ARFGGKEVALVAFVHGFILTAIVPFLLPLILTLFDY

>tg0807 Membrane protein, DUF340 family, putative
gtgatgtttctttacctcgttctcgcgtcgcttgttgcggggatccttgtggggcacctcttcactccagacttcgggaa
cgcctacgagataatgctctacgccctcatattcctgattggagtggatcttggcttgagcttcagcactggagagctca
gaaaggttggacggaaggcccttctcctgccgtttttaacgctgacgggctcaatccttggcggacttctggcggcactg
gttctcgggatagagatgagatggggcctcgccataggggctggctgtgggtggtactcgctgacaggcccgttgatagc
ccagtactctgccgtttacggtgcggtcggtttccttggaaaccttctaagagaaatcctgacgataacgctatatccgc
ttgcaattcgaaaactcaacccggagaaggccatcgtcattgggggagcgacgacgatggacacaactcttcccattatg
gcaaggtttggaggcaaagaagtggcgctggtcgcttttgttcacggtttcatcctgaccgctatcgttccgtttctcct
tccccttatcctcacgctcttcgactat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 759514 - 761101 (Additional range around tg0807 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGAAAAAGAAGTCGAGTGGAAAAGGGGAATGAAAGTCGCCGACGTCCTCAGGGAGGTTGGCTTCAACACGGAGAGCGCG ATAGCGAGGGTAAACGGAAAGGTGGTCCTTGAGGACGATCCCGTTGGGGATGGGGACTACGTGGAGGTCATTCCCGTCGT TTCAGGTGGCTGATCGACGAGTTTCAGAGAAGGATCTGCCTTTTGGACGGCGACGTTTTCAGCGTTTCGACAAAAGTTTT ATTAAATGCTGCTGGATAACGGGGATCATGATGATCTTTGTATTCCTTATCGCGGGCCTTTTGTTCGGTTATTTCCTCAG GAAAGCTGGAAAACGACCGAGCATGGAAACACCTATGAGTGTTGCGTTGCTCGCTATGATATTTTTCCTCGGAGTTAAAA CTGGTGAGGTTCATGTGAACGGTCTCTGGCTCCTCGGCGTTTCTGCGGTTTTTGCAGTTCTGACGATAGCTGGAAGCCTT TTCTTGGCGGAGGTGGTCGG gtgatgtttctttacctcgttctcgcgtcgcttgttgcggggatccttgtggggcacct cttcactccagacttcgggaacgcctacgagataatgctctacgccctcatattcctgattggagtggatcttggcttga gcttcagcactggagagctcagaaaggttggacggaaggcccttctcctgccgtttttaacgctgacgggctcaatcctt ggcggacttctggcggcactggttctcgggatagagatgagatggggcctcgccataggggctggctgtgggtggtactc gctgacaggcccgttgatagcccagtactctgccgtttacggtgcggtcggtttccttggaaaccttctaagagaaatcc tgacgataacgctatatccgcttgcaattcgaaaactcaacccggagaaggccatcgtcattgggggagcgacgacgatg gacacaactcttcccattatggcaaggtttggaggcaaagaagtggcgctggtcgcttttgttcacggtttcatcctgac cgctatcgttccgtttctccttccccttatcctcacgctcttcgactat TGACGAGTTTAATATTGGCATTAAGCGAAA ACCTTTTAAGGCTCAAGTCCGTTATGGTTCTTTAGGTGAAAGCGTATGGAGTCGGGAATAAAGTTGCTGAAGCGCAGGCT CGATGTTGTTAAGAAGCAGAAGGAATACCTGATCCTTGAGGAGGCCAAGCTCGTCAGGATGGCCCGCCAGAAGAAAAAAG TTGCCCACAAGCTTGAGCGGGTCAAGAGGGAGAAGTTCCGCGTTCTCGCTGAGGAGGCAAAGCTTCTTAGGGTTATAAAG CAGAGCGCCAAGCCGGCTTGAGATCTTTCCTTTTAAATCGCCTCGCTTTTCTCCACTTCCACCAAGCTTAAAAAGGTCTT TTCCATAGACTTCCCGGGACAAAAAGGAGAGGTGATTCTCATGCCAAGGAAGGCCAGAGAGTATCCTGAAGAGGGTGAGT TCGTCGTCGCCACCGTCAAGAACATTCACCCGTACGGAGCGTTCCTGATACTTGATGAGTACCCCGGAA