tg0808

Coordinates:760677-760889

>tg0808 hypothetical protein TGAM_0808
MESGIKLLKRRLDVVKKQKEYLILEEAKLVRMARQKKKVAHKLERVKREKFRVLAEEAKLLRVIKQSAKPA

>tg0808 hypothetical protein TGAM_0808
atggagtcgggaataaagttgctgaagcgcaggctcgatgttgttaagaagcagaaggaatacctgatccttgaggaggc
caagctcgtcaggatggcccgccagaagaaaaaagttgcccacaagcttgagcgggtcaagagggagaagttccgcgttc
tcgctgaggaggcaaagcttcttagggttataaagcagagcgccaagccggct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 760177 - 761389 (Additional range around tg0808 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGTTGGACGGAAGGCCCTTCTCCTGCCGTTTTTAACGCTGACGGGCTCAATCCTTGGCGGACTTCTGGCGGCACTGGTT CTCGGGATAGAGATGAGATGGGGCCTCGCCATAGGGGCTGGCTGTGGGTGGTACTCGCTGACAGGCCCGTTGATAGCCCA GTACTCTGCCGTTTACGGTGCGGTCGGTTTCCTTGGAAACCTTCTAAGAGAAATCCTGACGATAACGCTATATCCGCTTG CAATTCGAAAACTCAACCCGGAGAAGGCCATCGTCATTGGGGGAGCGACGACGATGGACACAACTCTTCCCATTATGGCA AGGTTTGGAGGCAAAGAAGTGGCGCTGGTCGCTTTTGTTCACGGTTTCATCCTGACCGCTATCGTTCCGTTTCTCCTTCC CCTTATCCTCACGCTCTTCGACTATTGACGAGTTTAATATTGGCATTAAGCGAAAACCTTTTAAGGCTCAAGTCCGTTAT GGTTCTTTAGGTGAAAGCGT atggagtcgggaataaagttgctgaagcgcaggctcgatgttgttaagaagcagaagga atacctgatccttgaggaggccaagctcgtcaggatggcccgccagaagaaaaaagttgcccacaagcttgagcgggtca agagggagaagttccgcgttctcgctgaggaggcaaagcttcttagggttataaagcagagcgccaagccggct TGAGA TCTTTCCTTTTAAATCGCCTCGCTTTTCTCCACTTCCACCAAGCTTAAAAAGGTCTTTTCCATAGACTTCCCGGGACAAA AAGGAGAGGTGATTCTCATGCCAAGGAAGGCCAGAGAGTATCCTGAAGAGGGTGAGTTCGTCGTCGCCACCGTCAAGAAC ATTCACCCGTACGGAGCGTTCCTGATACTTGATGAGTACCCCGGAAAGGAGGGCTTCATGCACATAAGCGAGGTGGCTCC AACCTGGGTCAAGAACATCAGGGACTACGTGAAGGAGGGCCAGAAGGTAGTCGTCAAGGTCATTCGCGTTGACCCCGAGA AGGGTCACATAGACCTGAGCCTCAAGAGGGTAAACCAGCAGCAGAGGAAGGCCAAGCTCCAGGAGTACAAGCGCGCCCAG AAGGCCGAGAACCTACTAAAGATGGCCGCTGAAAAGATAGGCAAGGACTTCGAGACGGCCTGGAGAGAGGTCTGGGTTCC GCTCGAAGAAGAGT