tg0833

Coordinates:783854-784702

>tg0833 ABC-type transport system, ATPase component, putative multidrug/lipooligosaccharide transporter
MPVIEVANVKKYYGEVRGVDGLSFSVEKGEIYGFLGPNGAGKTTTVKILVKIIKDYTGEVRVLGKDLREWGKEYYNKIGV
SFEFPAVYSRLTARENLGFFASFYKKHLDPTEVLKMVGLEEKADELVSGFSKGMKKKLDLARALLPDPEILFLDEPLEGL
DPASARRIKDLLLEMRESGKTVFLTTHNMYVADELCDRVAFIVDGSIRLVDNPGELKVKMGKRLVKVEYVANGSVAVKEF
PLENIGQNEEFLRVIREHEVRRINTEEPTLEEIFLKVTGRRLV

>tg0833 ABC-type transport system, ATPase component, putative multidrug/lipooligosaccharide transporter
atgccggtgattgaggttgcgaacgttaagaagtactacggcgaagtcagaggtgttgatggactgagcttctccgtaga
gaagggcgagatatatggctttctcggaccgaacggggctggaaagactacgaccgtcaaaatcctcgtgaagatcatca
aggactacactggagaggttagggtgctcggcaaagatttgagggagtggggtaaggagtactacaacaaaatcggcgtt
tccttcgagtttccggccgtttattcaaggctcaccgccagggaaaacctcgggttcttcgcgagcttctacaaaaagca
cctcgaccccaccgaagtgctcaagatggtcggcctggaggagaaggcggacgaactcgttagtggcttttcgaagggca
tgaagaagaagctcgacctcgcgagggctctgctccctgacccggaaattctcttcctcgacgagccgctcgaaggcctc
gacccggcgagcgcgaggaggataaaggacctgctcctggagatgcgtgaaagcggaaagacggtcttcctgaccaccca
caacatgtacgtggccgacgagctctgcgacagggtcgccttcatcgtggacggctccataaggcttgtggacaaccccg
gcgagctgaaggtgaagatgggcaagcggctcgttaaggtggagtacgtcgccaacggcagtgttgccgtgaaggagttc
ccgctggagaacatcggccagaacgaggagttccttagggtcattagggagcacgaagttaggagaataaacacggagga
gcccaccctggaggagatattcctaaaggtgacggggaggaggctcgta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 783354 - 785202 (Additional range around tg0833 is :500nt.)

>Thermococcus gammatolerans EJ3 TCAACCCTTTTCCGGATTCTCATAGACAGAATCAACTATGAGTTTTTTGACGCCTTCAAATGGTTCATGGAGCTGGTCGA GTGGGGCTACGGGGACACCTACTTCTTCCTCGGGAGCGACGTGATGAAGCTCGTTGAGATAAAGTTCAAGGAAGAGGTGA ACCCGGAAGAAATCACTAAAAGACTCCTCGAAATCCCCCACGTCAAGGACGCAAAGCTCATCGGAAAGCAGCTTGAAACA CTGCTCCTGGCATACAAGAGCGGCTACTTCGACAGTCCGGGGAGGGTTACTCTAAGAGATCTCGCCGAGATGCTGAACTC GGCCCCTCAACGGTGAAGGAGCACCTTCCTTAGGATTCCTTCGGGGGTTGGCTCCTGTTATCCTAGAATTTTGGGAAATT CACTATTCCCTAACAAATTTGCTATTGGGTCATATACTCCCGCACATGTGCAGGACTAACTATAACTACTTTGAGGCCCT ATTTTAAATTGGTGAAAAC atgccggtgattgaggttgcgaacgttaagaagtactacggcgaagtcagaggtgttgat ggactgagcttctccgtagagaagggcgagatatatggctttctcggaccgaacggggctggaaagactacgaccgtcaa aatcctcgtgaagatcatcaaggactacactggagaggttagggtgctcggcaaagatttgagggagtggggtaaggagt actacaacaaaatcggcgtttccttcgagtttccggccgtttattcaaggctcaccgccagggaaaacctcgggttcttc gcgagcttctacaaaaagcacctcgaccccaccgaagtgctcaagatggtcggcctggaggagaaggcggacgaactcgt tagtggcttttcgaagggcatgaagaagaagctcgacctcgcgagggctctgctccctgacccggaaattctcttcctcg acgagccgctcgaaggcctcgacccggcgagcgcgaggaggataaaggacctgctcctggagatgcgtgaaagcggaaag acggtcttcctgaccacccacaacatgtacgtggccgacgagctctgcgacagggtcgccttcatcgtggacggctccat aaggcttgtggacaaccccggcgagctgaaggtgaagatgggcaagcggctcgttaaggtggagtacgtcgccaacggca gtgttgccgtgaaggagttcccgctggagaacatcggccagaacgaggagttccttagggtcattagggagcacgaagtt aggagaataaacacggaggagcccaccctggaggagatattcctaaaggtgacggggaggaggctcgta TGAGGAATAT CGTCAGAACGAACATTGTTCTCGGGGTGAGGAGCTACGTTTATCCCATATACCTGCTCGTGGCCTTAGCTTATGGCCTCA TGCTCCTTGCCTTCCCGGAGCGCTACCTCCCGACGATGGTGCCGATCTTCCTCCTTTTCGAGCCGGGGCTCGTTGGCTTC ATGTTCGTTGGCACGGAGATATTCGCCGAAAAGAAGGACGGCGCGATAGGCGCTCTGGCGGTCACACCGATAGACTGGAG GAGCTACATCCTGGCCAAAACACTCCTCCTGAGCCTGCTCTCAGTCATCGGGGCGGTGCTCATAATGGCAGTAGGCACCC GCTCCCTCAACGGGCTTCCGTATGTGGTTGTTGGGACCTTTCTCGTCTCCATAGTTTACACGCTCCTTGGAATAGCGGTC TCGGCCAAATACCGCGACCTCGACGACTACTTCATCCCGATACTGGGGGTTCTGGTGGTCTCGCTCCTGCCCTTCGCGCA CTACCACGGC