tg0842

Coordinates:790225-790608

>tg0842 Dinitrogenase iron-molybdenum cofactor, NIF B/Y/X related
MRIAVPAVDDRGLESEVSGHFGRARYFVFVDVEDGEIKDFEVVEVPFEEHGPGDLPRFVKEHGGEVVIAYGMGQRAISFF
NELGIEVVTGAYGKIRDVVEAFIHQVLEVDPHWKEKIEREKEREGHRH

>tg0842 Dinitrogenase iron-molybdenum cofactor, NIF B/Y/X related
atgaggatagcggttccggctgtggatgacagaggcttagaaagcgaagttagcgggcacttcggcagggcaaggtattt
tgttttcgtggacgttgaagacggcgaaataaaggatttcgaggtcgttgaggttcccttcgaggagcacgggcccggcg
accttccgaggttcgtcaaggagcacggcggggaggtcgtcatcgcctacggaatgggtcagagagctatctcattcttc
aacgagctcggcatagaggtcgttactggtgcctatggaaaaataagggacgttgtcgaggcgttcatccatcaggttct
tgaggttgatccccactggaaggagaagatagagcgcgaaaaggaaagggaagggcaccgccac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 789725 - 791108 (Additional range around tg0842 is :500nt.)

>Thermococcus gammatolerans EJ3 TTTCTATAACATTCGAGCTAAACTCGCCTGAAAGCGGTAATTTTATAAAGATAAAGAGGTAATAATCAACGGTGGTGAAG GTGCCGAAGTGGATGATGGGTGACATGGCAGTTTTGAAGAACCTCATGATGACCCTCAAGCCCTTGATGGCCGAACCTAG GCGGAGCATCATAAGAATCCTGAGCGATGGCATAAAGGGGACAAACGAGATATACCAGGCCCTTCAGGAGAGGGGCCTCA ACATGCCCCGCTCAACGCTCTACTACCACCTCTCTGCCCTCGAGGACATGGGGATAATCGAGATGGCGGGTTACAGAGAG GTTGGTGGCGGAGCGCCCGAGAAGCTCTGGAAGCTTAAGGTCAGGAAGGTCGGCATAGATCTCGTCACGGGGGAGATATT CAGGGAGTGAGTTACCTGCCTTGAAGCGGAGTTTCGTTGTTTTGTGCCTATGCACAAAGCTTATATGAGAAAAAAATTTC AATTAAGCGGGGGATGTGGC atgaggatagcggttccggctgtggatgacagaggcttagaaagcgaagttagcgggca cttcggcagggcaaggtattttgttttcgtggacgttgaagacggcgaaataaaggatttcgaggtcgttgaggttccct tcgaggagcacgggcccggcgaccttccgaggttcgtcaaggagcacggcggggaggtcgtcatcgcctacggaatgggt cagagagctatctcattcttcaacgagctcggcatagaggtcgttactggtgcctatggaaaaataagggacgttgtcga ggcgttcatccatcaggttcttgaggttgatccccactggaaggagaagatagagcgcgaaaaggaaagggaagggcacc gccac TGAGTTTGGGAGGCGTTCAGGAAAGTTTTTAAATTTTTTTCATATGAGTTTCCCCCGGTGAAGCAGATGAAGGT GAGCGTAAAGGACTTCGCACCGAGCTGGTTCGCGAGCGTTATGGGAACGGGAGCTCTCGCTTTGGCCAGCAAAGCTTATT CATCGAGGATTCCGGCCTTAGGTGGACTGGCGGAGTTTCTCGTCTACTTCAACACGCTCCTGTTCTTCATCCTCCTAATC CCATGGCTCCTCAGGTGGGTGAAGTACACGGAAAACGCCCTGGAAGACCTCAAGCATCCAATGGTGAGCCACTTCTACGG GACGATAGCCGTGGCCATGCTCGTACTCTCGGCGGATTACCTCTTCATACTCAAGAAGACTGCAATAGCGAAGGCGTTCT GGATTCCGGGAGCAGTTCTAACGATATTCTTTGCCCTGCTCATCCCCTACCTGATGTTCGTTGAGAAGGAGATAGACCTA AAGTCCGTTACCCCGGCCTGGTTCA