tg0854

Coordinates:800074-800661

>tg0854 Bacterial regulatory protein, arsR family
MESEMGKLLDILGNETRRRILILLTKRPYFVSELSQELGVGQKAVLEHLRILKSAGLIEERTEKIPRGRPRKYYTIRRGF
RLEVMLTPYLFGTELYEPKEVRKTSVYSEAQRLIKSTEPTEEKVRELVEFLDSLETRLNEMLEVKRELEEVRLMVETYIE
NLLRRVAQEDERLFEEIMHELGPKLPRRISTNLNDF

>tg0854 Bacterial regulatory protein, arsR family
atggaatcagagatgggaaagctccttgatatccttgggaacgaaaccagaagaaggatactcatccttctcaccaaaag
gccctatttcgtcagtgagctgagccaggagcttggagttggtcagaaggcggtactggagcacctgcggatcctcaaga
gcgcgggtctgatagaggagaggaccgaaaaaataccccggggacggccaagaaagtattacaccataaggcgaggcttc
aggcttgaggtaatgctcactccctacctctttgggacggagctctacgagcccaaggaagtcaggaagaccagcgttta
ttcagaagctcagaggctaataaagtccacggagccaacggaggagaaagtgagagagctcgttgagttcctcgatagcc
ttgagacgagacttaacgagatgctggaagtcaaaagggaacttgaagaagtcaggcttatggtcgagacctacatcgag
aacctccttaggagggttgctcaggaggatgaacgactctttgaggaaataatgcacgagctgggtccaaaactcccgag
gagaatttcaacgaaccttaacgacttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 799574 - 801161 (Additional range around tg0854 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCCTTCCTCCTCGCTTATTCCACACCGATAACAAAATCTCTCGCCCATTCCTCTCACCAGTTTCGAGTTGGGATGAGGG TTTAAAAAGTCTCAGAAGAGGAGCTTCGCCATCTGGGCGTGGGGAACGCCTTCAATCCTGAGAACCCTTTCGGGGTTAAC GTAGCCGAGTTCGATGGCCTTGGTGACACAGCGCTCCCCTGTTAAGTTCGCTATCGTGGCCTCCTTGAGGAGCTCCCCGA GCTTTGCCTCCTCAACAAGTTCGCCCTTGTAAAAGCGCTCCTTGACCTCGAGCTTTAGCTCGCCCTCCCGGAATGTCTTT CCAAGCAGTTCTTCGTCACAGGCCGCAAGGAGTACCTCCCCCTGGACACGGTAGATCCTGACGTATATCATTCCCATCCC CCGCTGTGGTGTGAGGTGCATCTTATAAACCTGCTCCAACCAAAAAACTTAAAGGCAGTTTTTCTAACATTAAGTTAGTA AGTGAGTTGGGGGTGAGATT atggaatcagagatgggaaagctccttgatatccttgggaacgaaaccagaagaaggat actcatccttctcaccaaaaggccctatttcgtcagtgagctgagccaggagcttggagttggtcagaaggcggtactgg agcacctgcggatcctcaagagcgcgggtctgatagaggagaggaccgaaaaaataccccggggacggccaagaaagtat tacaccataaggcgaggcttcaggcttgaggtaatgctcactccctacctctttgggacggagctctacgagcccaagga agtcaggaagaccagcgtttattcagaagctcagaggctaataaagtccacggagccaacggaggagaaagtgagagagc tcgttgagttcctcgatagccttgagacgagacttaacgagatgctggaagtcaaaagggaacttgaagaagtcaggctt atggtcgagacctacatcgagaacctccttaggagggttgctcaggaggatgaacgactctttgaggaaataatgcacga gctgggtccaaaactcccgaggagaatttcaacgaaccttaacgacttt TAGGAAGCGGAAAAAGCTGAAAAATGAAGA AGACACTTGATACCCTGATCAGAGAATTTTGCCCTCTTCCTTCATTCTGACGAGCCTGGTTATATATCCCGCTATCCTGT TTCTTATGGTCTTGCTCGTTACGTTTGTGAGCTCCTGAACCATCCTCTTGTTGTGCTCAAAGTCCCTTGTGAACTTGTCA GGATACCTATCAAAGAGCTCGCGAGCGGTCCTCTTGATGAAAGCCTGCTTTATGTTTCCCATTCTCATCACCTCGGATTA GCTTAAGCCGTAACCCAATCCGGGGAATCTTTTTAAAAGTTTTCCCTGGGGGAGAAAAAGCTACCGTTTTCTCAGCTTCT CGTAAATTCATTCGCCGAGGTGGATTGAGGTTTTCTCTGGCCAGACGATGCTGAGGGAGTAGCACCTCACCAGTGCAAAG CCAAAGTTAATCATTTCGAAATGGCTGAGCTCTTCTGTCAATTGAGAGGACAGAGTTAGACCCCGAACC