tg0855

Coordinates:800713-800913

>tg0855 SSU ribosomal protein S17E (rps17E)
MGNIKQAFIKRTARELFDRYPDKFTRDFEHNKRMVQELTNVTSKTIRNRIAGYITRLVRMKEEGKIL

>tg0855 SSU ribosomal protein S17E (rps17E)
atgggaaacataaagcaggctttcatcaagaggaccgctcgcgagctctttgataggtatcctgacaagttcacaaggga
ctttgagcacaacaagaggatggttcaggagctcacaaacgtaacgagcaagaccataagaaacaggatagcgggatata
taaccaggctcgtcagaatgaaggaagagggcaaaattctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 800213 - 801413 (Additional range around tg0855 is :500nt.)

>Thermococcus gammatolerans EJ3 CACCGAATTGAGTTATGTTTTCTGTTTCCCAACGTCCGAAGGATATTTTTTGATAGTTGAAAACGATAGAAGGGTAGAAA TTTGGGTAGGGATCCCCAACGGGCTCGGCAGTTGAGTGGCGCCGGGGCAGGGATTTGAACCCTGGCGGGCGGACGCCCAC GGGATCTCGAGTCCCGCGCCTTCCCAGGCTAGGCTACCCCGGCGCTCACCAATGACGAGAAAGGAATGGAGTTTATAAAT TTTTAGGATTCAGGTTCGGGGTCTAACTCTGTCCTCTCAATTGACAGAAGAGCTCAGCCATTTCGAAATGATTAACTTTG GCTTTGCACTGGTGAGGTGCTACTCCCTCAGCATCGTCTGGCCAGAGAAAACCTCAATCCACCTCGGCGAATGAATTTAC GAGAAGCTGAGAAAACGGTAGCTTTTTCTCCCCCAGGGAAAACTTTTAAAAAGATTCCCCGGATTGGGTTACGGCTTAAG CTAATCCGAGGTGATGAGA atgggaaacataaagcaggctttcatcaagaggaccgctcgcgagctctttgataggtat cctgacaagttcacaagggactttgagcacaacaagaggatggttcaggagctcacaaacgtaacgagcaagaccataag aaacaggatagcgggatatataaccaggctcgtcagaatgaaggaagagggcaaaattctc TGATCAGGGTATCAAGTG TCTTCTTCATTTTTCAGCTTTTTCCGCTTCCTAAAAGTCGTTAAGGTTCGTTGAAATTCTCCTCGGGAGTTTTGGACCCA GCTCGTGCATTATTTCCTCAAAGAGTCGTTCATCCTCCTGAGCAACCCTCCTAAGGAGGTTCTCGATGTAGGTCTCGACC ATAAGCCTGACTTCTTCAAGTTCCCTTTTGACTTCCAGCATCTCGTTAAGTCTCGTCTCAAGGCTATCGAGGAACTCAAC GAGCTCTCTCACTTTCTCCTCCGTTGGCTCCGTGGACTTTATTAGCCTCTGAGCTTCTGAATAAACGCTGGTCTTCCTGA CTTCCTTGGGCTCGTAGAGCTCCGTCCCAAAGAGGTAGGGAGTGAGCATTACCTCAAGCCTGAAGCCTCGCCTTATGGTG TAATACTTTCTTGGCCGTCCCCGGGGTATTTTTTCGGTCCTCTCCTCTATCAGACCCGCGCTCTTGAGGATCCGCAGGTG CT