tg0860

Coordinates:805333-805905

>tg0860 Zinc-dependent protease, archaeal type, predicted
MGWEMIAIVSIGPVEKWLIEGILDFVGYYYSRFNLKVKFSGNLPGEPFSVALHPSRGQYLGRVFLPTLAALRRKIGATAI
LGVTDLDLYEEGLNFIFGLANRSLRSALISTRRLRNEFYGLPPDDDLLLERAIKEAMHELGHVFGLEHCPNPRCVMHFSN
SIHDTDVKGPLYCPRCEGKLKGNLRKLGVLS

>tg0860 Zinc-dependent protease, archaeal type, predicted
ttggggtgggagatgatagcgatcgtttctatcggcccggttgagaaatggcttatagaggggatcctcgatttcgtggg
ctattactactcacgctttaacctcaaggtcaagttttcaggcaatcttcccggggaacccttctccgttgcgctccatc
catccaggggccagtacctcgggagggtattccttcccacactcgccgccctgaggcgaaaaataggggcaacggccata
ctgggggtcaccgatctcgacctctatgaggaaggcctaaacttcatcttcgggctcgccaaccgctccctcaggagtgc
cctaatctccacccggaggttgagaaacgagttctatggcctgcctcctgacgatgatctcctccttgaaagggccataa
aagaggcgatgcacgagctgggtcacgtcttcggtctggagcactgtcccaatccgaggtgcgttatgcacttctcaaac
tccatccacgacacagatgtcaaagggcccctctactgcccaaggtgtgagggtaaactcaaggggaacctcagaaaact
gggggtgttgtcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 804833 - 806405 (Additional range around tg0860 is :500nt.)

>Thermococcus gammatolerans EJ3 GAACCACGAGGCAGACATCTACTTCGTCGCCTCCGTGCAGGAGGAGGTCGGTTTGAGGGGTGCTAGAGTTGCCAGCTATG CCATCGATCCCGAGATAGGCATTGCGATGGACGTCACCTTTGCCAAGCAGGTCGGCGACAAGGGCAAGATTGTGCCCAAG CTCGGTGGGGGCCCGGTCATGGACGTCGGCCCAAACATCAACCCCAAGGTTCGTGCCTTTGCCGACGAGGTTGCAAAGAA GTACAACATCCCACTCCAGGTGGAGGCATCTCCAAGACCGACAGGAACCGACGCCAACATAATGCAGATCAACAGGGAGG GCGTTGCAACTGCTGTCCTCAGCATACCGATACGCTACATGCACAGTCAGGTCGAAACTGCCGACCTGAGGGACATCGAC AAGACCATCGAGTTTGCCAAGCACTTCCTTGAGGAACTCAGGCCAATGAACCTCATCCCGTGAGGGGAAAGGTTTATTGG CCTCTCTTTCTTCTCCCTA ttggggtgggagatgatagcgatcgtttctatcggcccggttgagaaatggcttatagag gggatcctcgatttcgtgggctattactactcacgctttaacctcaaggtcaagttttcaggcaatcttcccggggaacc cttctccgttgcgctccatccatccaggggccagtacctcgggagggtattccttcccacactcgccgccctgaggcgaa aaataggggcaacggccatactgggggtcaccgatctcgacctctatgaggaaggcctaaacttcatcttcgggctcgcc aaccgctccctcaggagtgccctaatctccacccggaggttgagaaacgagttctatggcctgcctcctgacgatgatct cctccttgaaagggccataaaagaggcgatgcacgagctgggtcacgtcttcggtctggagcactgtcccaatccgaggt gcgttatgcacttctcaaactccatccacgacacagatgtcaaagggcccctctactgcccaaggtgtgagggtaaactc aaggggaacctcagaaaactgggggtgttgtcg TGATTGAAGTTGAGCTGAAGGGCTACGCGGACGATTCCGTGTTTGA GAGAGTTCGTGAGGAGTTTAGACTAATAAGGAGGGAGTACCACGAGGACACCTATTACCAGCATCCCTGCAGGGACTTCT CAAAAACGGACGAAGCATTGAGAATCAGAATAAGGCGTTTCAACGGCCACTTCGAGGCGTTTTTAACCTACAAGGGACCC AAGATTGACTCAGTTTCGAAGACCAGGGAGGAGATAGAGGTTCAAATAAACGATCCCGATGAACACGCCCGCATTTTAGA GGCCCTGGGCTTCACGGAGGTTCTGACCGTTGAAAAGATCCGGGAGAAGTATTACGTCGAGAAGGGCATTACGCTGACCC TCGACGAGGTTGAAGGGCTCGGTAAGTTCGTCGAGGTTGAAGCCCTAACCGAGGATAAAAGGAAGGTCCCCGAACTCGTT GAGAAGCTGAAGAAGATCCTCTTTGATCTCGGGGTTACGCGCTTTGAGAGGCGC