tg0869

Coordinates:811882-812214

>tg0869 hypothetical protein TGAM_0869
MNVNWFIIGPIVTFLVNIPFGFWRAHAKRTGNRLEWALAVHLPVPLVVVLRHLAGLSWNSSGAPLILVFVLAYFLGQRTG
GKLYQRAHESGLNPGRNVFVLWSGRGEGEAI

>tg0869 hypothetical protein TGAM_0869
atgaacgtaaactggtttatcatcggccccatagtaacgtttctggtaaacataccgttcggcttctggagagcccatgc
caagaggacgggaaacaggctggagtgggctttggctgttcaccttcctgtcccgctggtcgtggtgctgaggcacttgg
cggggctcagctggaactccagcggggcgccgctgatactcgtcttcgttcttgcctacttcctcgggcagagaacgggc
ggaaagctctatcagagggcccacgagagcggtttgaatccgggcagaaacgttttcgtcctttggagtggaaggggaga
gggagaggctatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 811382 - 812714 (Additional range around tg0869 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGGGTCGTCGTGCCTTCCTCTTGCCTTTAACCTCTCGAAGCGGAGCCTTGGTGGCGTGTGGACAGCAACGATGATGATT TTTTCCTCAGGAAAGGCCCCCCTAAAGGTTCCCACCTCGTCGAGGGAACGGACGCCGTCTATGACCACGAGCGGGCTCTT CTCCAAAAGAACCCTCACCTTCCCGACCGCGAGCTTGGCAACGGCGTTCTGACCGAGCTCCTGCCTCAACCTTATACTTA CCTTGGCGACGTTCTCCTTGGTGAGCTCGAGGCCCCGCTTTACGGTCTCCTCGCGGACGATGTCGCCGAGAGAAACGCTG GGAAAGCCCCTCTTCTCGAATTCCTCCACAATCCTGCTCTTACCTGAACCGGGCATTCCAGTGACTATTACTATCATTGA GCCCACCCCGAGTAGCTCGGGAAGGATTTAAAAAGGTTGAGTCCTGTTAGGGGGGCAAAACTTTTTAAGGTTCAGTATGA AAACCATCATGGTGGGAAAG atgaacgtaaactggtttatcatcggccccatagtaacgtttctggtaaacataccgtt cggcttctggagagcccatgccaagaggacgggaaacaggctggagtgggctttggctgttcaccttcctgtcccgctgg tcgtggtgctgaggcacttggcggggctcagctggaactccagcggggcgccgctgatactcgtcttcgttcttgcctac ttcctcgggcagagaacgggcggaaagctctatcagagggcccacgagagcggtttgaatccgggcagaaacgttttcgt cctttggagtggaaggggagagggagaggctatc TGAGGAAGTCCTCCAGAGTCCCCTTTCGCTTTGGCTTTTCTTCCG TTACCCTCTTCTCGATTCCAAGGTGGCGGTAGATTCCGTCGAGGATTTTGGCACCTATTCCCTCGACCGCCAAAAGCTCC GCAGGTTTTGCGTTCGCTATCGCCTCAACGCTTCTAAACCCCGCGTTGTAGAGAGCCCTCGCCCTCTTCCTTCCGATGTT CGGCAACCTGACGAGTTCGAGGAGCTCTTCTCTAACCCCGTGCCTCAGGCGAAGGTGCAGGTCGCGGAGGTAGTTCAGGA TTTCCTCCTTCGGCTCGAAGAGCTTGTAGAGCTCGATGAGCGAGTACATGAGCCAGTCGGCAAGCTCAAGAAGCCTGTAG AGGTCGCCGGGGTCTATCGAGTAGGTCTCGTAAATCCTCGCCTCGGGAACCTCGTTAATCCAGTCGAGGAGAACCTTGGC AGTCTTCACCTGACCGAGGAAGCCCTGGAAGCGCGAGTCTTCGTAGTAGGGTAT