tg0871

Coordinates:814445-815005

>tg0871 hypothetical protein TGAM_0871
MAVEVPYVLFRTRSGVYGIDGYFYPALERVEHRAALLRKMPPKPVPRAYGDSYVTPSNVGKVLRELALELYELTGRSFDE
RGRHMRRWNILRFLGIPSGYIKNLKRDEELAGRVRRALLALSIVEHVLGIKGPADLDDLFVEPLGWSVFRLEIVKGRPVD
PVYSQLYEDDAGFRRALHEVLKKEGGL

>tg0871 hypothetical protein TGAM_0871
atggccgtagaggtaccctatgtgctcttcagaacgagatctggggtttatgggatagacggctacttctaccctgccct
tgagagggttgagcacagggccgccctgctgaggaagatgccaccgaaacctgttccccgagcctacggggactcctacg
tgaccccaagcaacgtggggaaagtcctcagggagttggcccttgagctgtacgaactcaccggcagaagttttgatgaa
aggggccgacacatgagacgctggaatatacttcgctttctgggtattccttccggctatattaagaacctgaagcggga
cgaggaacttgccgggagggtgaggcgggccctgttggccctctcaatagtggaacacgtcctcgggataaagggccctg
ccgatctggatgaccttttcgttgagcccctcggatggtccgttttcaggctggagatagtgaaaggtagacccgtggat
ccagtttattcacagctttacgaagacgacgcgggttttagaagggccctccatgaagtgttgaaaaaagaaggggggtt
a


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 813945 - 815505 (Additional range around tg0871 is :500nt.)

>Thermococcus gammatolerans EJ3 ACCACGAGCTTAACGTCGTTAATCCACCTCGCGCCGTGCCTGAGAAGGGAGTCGAACTTCTCGGCGGTGGCGACTATTAT GTCGTACCGCCCAAGCCAGTCGTCGGTTGAGTCGTAGTCTCCTGTGGTTGCCGCGACCTTCAGACCCAGCTTCTCCCACT CCTTGAACTCTCGGTATTTCTCCTCCGCCAGGGCCTTGAGGGGGACGAGGTAGACTGCCTTGCCCCCCTCTTGGATGAGC TTGTTCACCATAACTATCTCGCTCACGAGAGTTTTTCCGCTCGCCGTTGGGATTGCCAGAACGAGGTTTCTGCCCTCTAA GGCACCGCTCTTCAATGCTTCCGCCTGCGGTGGGTAGAGTTCCTCTATGCCCCTCTCCTTGAGGACTGCCTTAAGCCTCT CGTCAACGGGAAGTTCATCAACCTTCATCTACCCTCAGCTCCACATCCCTTTGATCGGCGGTTTTATATGTCTATTGTCT TACACTAGGCGGGATGTGCG atggccgtagaggtaccctatgtgctcttcagaacgagatctggggtttatgggataga cggctacttctaccctgcccttgagagggttgagcacagggccgccctgctgaggaagatgccaccgaaacctgttcccc gagcctacggggactcctacgtgaccccaagcaacgtggggaaagtcctcagggagttggcccttgagctgtacgaactc accggcagaagttttgatgaaaggggccgacacatgagacgctggaatatacttcgctttctgggtattccttccggcta tattaagaacctgaagcgggacgaggaacttgccgggagggtgaggcgggccctgttggccctctcaatagtggaacacg tcctcgggataaagggccctgccgatctggatgaccttttcgttgagcccctcggatggtccgttttcaggctggagata gtgaaaggtagacccgtggatccagtttattcacagctttacgaagacgacgcgggttttagaagggccctccatgaagt gttgaaaaaagaaggggggtta TGATTTGGCGTAAAGCCAGCAGGCGACGTAGTGATCCTTCTCAACCTCCACCAGAGG AGGCTCCTCTTTCTTGCACCTGTCCATAACCCTGGGACATCTCGGGTGGAAGCGGCAGCCCTTCGGCGGGTTTATTGGGC TCGGAGGTTCTCCCTCTATCTTCATCCGCTTCCTCTTGAGTTCCTGCGCCAGTTCCGGATCGGGAACGGGAATCGCCGAC AGGAGCATCTGGGTGTAGGGATGCAGTGGGTTCTCAAAGATCTTCTCCGCTGGACCGACTTCAACGAGCTTTCCGAGGTA CATCACGCCCATTCGGTGGCTCATGTACTTGACGACACCGAGGTCGTGACTTATGAATAGGTATGTGAACCCGTACTTCT TCTGGAGATCTTTGAGCATGTTGAGTATGTTCGCCTGAACCGAGACGTCTAGGGCAGAGGTGGGCTCGTCGAGTACAATG AACTCTGGCTTGAGGGCCAAGAGCCTCGCGAGGGCTATTCTC