tg0884

Coordinates:825330-825650

>tg0884 hypothetical protein TGAM_0884
MGQKIIVNGEVKQLPKVFNSEEELAEFLDEVLERALKNPDYASKFKEGSVTLTVELSDVGIYKEGITSVEFAFEYKNGIH
YLKTTYSKTGYNVWAYKPWKRVIEPVG

>tg0884 hypothetical protein TGAM_0884
ttggggcagaaaatcatagtgaacggtgaggttaagcaacttcctaaggtctttaatagtgaggaggagctggcagagtt
ccttgatgaagtactggagagggcactcaaaaatccggactatgcgagtaagttcaaggagggtagtgttaccttaactg
ttgaactttcggacgttggcatttacaaggagggcataacatcagtagagtttgcattcgaatacaaaaacggtatccac
tacctaaagacgacatattcgaaaacaggatacaatgtttgggcttacaaaccatggaaaagagttatagagcctgtggg
g


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 824830 - 826150 (Additional range around tg0884 is :500nt.)

>Thermococcus gammatolerans EJ3 GGAGCTTTACTAGAACCTGATGAACAGGGAGGCTGCAACAGACATCGAGAAATGGCTAGAGAGTATGGTTTCAACGTTGC CAATGACACTCCCATATACCGTTCAGTACTGGCGATGCAATCTTATGTTTTCTTTGAGAGGATTGGGGATAGTGTGAAAA TCCATTATTATAATGGTCTTCTTGAGGGGACTGATTGTCCGGAGTATAAGGGTAAGCATAAGGGTACTATTGAGGTTCCA TTAATCGAGTTTGGGGAGGATGTTTTGAGGGTTTTTGGCGAGTACTTGGAGAGGCACTACAAGCGCGTTGAAAAAGTCAG ACAAGAAGCCTACGGATACAACAGAATGGATGAGTATAAGCTTTATCTAAAGCAATACTTAGAGGATTTAGAGGACTGGA AGACACTGAAAGAGAAATTAAAGGTCAGCAAAAACAAATGAAAATCTTAAAAAGTGTGATCTTCTCAGATAATTACCTAA TTTTTTAGTGCTTGGTTTA ttggggcagaaaatcatagtgaacggtgaggttaagcaacttcctaaggtctttaatagt gaggaggagctggcagagttccttgatgaagtactggagagggcactcaaaaatccggactatgcgagtaagttcaagga gggtagtgttaccttaactgttgaactttcggacgttggcatttacaaggagggcataacatcagtagagtttgcattcg aatacaaaaacggtatccactacctaaagacgacatattcgaaaacaggatacaatgtttgggcttacaaaccatggaaa agagttatagagcctgtgggg TGAAGGACATGAAAGAGGTAGTCCTCCGAGGAAAGCACATTTCACTGAAGATATACCT TAAAAAGGCCCTTGATTTAGTCTTTCCTTTTCCAATTCTTCTTTTTAATCGATGATAATCTAATCGCCGGAACCTGCTGG ATTGGAAAGGATGGAAATAAAGAGCTGTATCCAATTCAGGGGGATCCTGCAGGAATTATTCAGGAGTTTCTCTACTGCTG TGATTTCCTTATTAACAGTGAAAAACTTGAAGGAGGAGGTTTTATCGGTAACCTCAGGGAGTATGCGCGAAAACTAGACT TTCCTATAAAGAGAAATACAAAGCTGTACTTTACAAGCCTAGTGATATACTTGGGCGAGTACATCTTCGAACTTGATGGG AATATCATAAATGTCCATTACAACAACATTCCTCTAAAGGATACGAACTGCCCAGAATTTATAGGAAACTGGAAGGGGAC AGTGTCTGTCCCCCTGAATGATTTCGTGCAAGATGTACTAAG