tg0891

Coordinates:829044-829646

>tg0891 hypothetical protein TGAM_0891
MRCRLRGKFIEIEIDMESFEPEPFPGRFPILFLVAGHEVGGYPDEGWLGDLYALFQDLLLCTRDLLKYPESCFNKRKNAE
NDGFDLLPDSYVCGPILDLDFNTYYLERKGELLRFHFINEAPRYISSKNPLQGTIELLFEAFVADILKISEEYLEKCFPI
EMEIKATQYDGFAEEISRLRRYLENLIQEIKTELDLSIALY

>tg0891 hypothetical protein TGAM_0891
atgaggtgcagacttcgtggaaaattcattgagattgaaatagatatggaatcctttgagccagaaccatttcccggccg
ttttcctattctttttttggtggctgggcatgaagtagggggataccccgatgagggatggcttggcgacttatatgctc
tctttcaggatctacttctctgtactagagatctcctgaagtaccctgaaagttgttttaacaaaaggaaaaacgctgag
aatgacggttttgatttattgcctgatagctatgtctgcgggccaatacttgaccttgattttaacacgtattatctcga
aagaaaaggggaattgttgcgttttcatttcataaatgaggctcccagatacatttcctcaaagaaccctcttcagggca
ccattgaattactgtttgaggccttcgtcgccgatattctcaaaataagcgaggagtaccttgaaaaatgcttcccaata
gaaatggagattaaagccacgcaatatgacggatttgcagaggaaatttctcggcttaggcgatacctagaaaacctcat
acaagaaattaaaacagagctggatttaagcattgcattatat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 828544 - 830146 (Additional range around tg0891 is :500nt.)

>Thermococcus gammatolerans EJ3 TGTTTTGAAAATCAGCAGGGAGTATCTGGAAAAGTACGCTTCAGTCATCGAGAAAATCAGGCTTGAGCACGGGGAAGAGC TGGACGATTATGACTTCCTCTGGGGGCTTTACCGGGAAGTTAAAGACCTGTACGAGAAGAAGTTCAGGCCAGAAAATCGT TGACCTCAAAACCGGGAGGGTTGTCCAGATCCCTAAGGTCTTCAGGGACGAGCACGAGCTCAGAGAGTTCCTTGATGAAG TACTGGAGAGGGCCCTTCAGAAGGAAGAGTACTACACAGAATTTAGGGGACAGAGCTTTGTGAAGCTAAGGGTAAACTTG GATAAGCTTGGCATGCACATAGATGGAATAGATGCGGTGGAGTTCCAGTTCTCATACAACCAAGCTAAGGGTGCCTACGA GATCATTACGGCGTATCCCTCAAAAGGCAGGAAAGTTTTAGGGTACGTGTGGGACAGAGAAAAACAATCTGGTAGATGGA TATACATGGGGTGACTTCA atgaggtgcagacttcgtggaaaattcattgagattgaaatagatatggaatcctttgag ccagaaccatttcccggccgttttcctattctttttttggtggctgggcatgaagtagggggataccccgatgagggatg gcttggcgacttatatgctctctttcaggatctacttctctgtactagagatctcctgaagtaccctgaaagttgtttta acaaaaggaaaaacgctgagaatgacggttttgatttattgcctgatagctatgtctgcgggccaatacttgaccttgat tttaacacgtattatctcgaaagaaaaggggaattgttgcgttttcatttcataaatgaggctcccagatacatttcctc aaagaaccctcttcagggcaccattgaattactgtttgaggccttcgtcgccgatattctcaaaataagcgaggagtacc ttgaaaaatgcttcccaatagaaatggagattaaagccacgcaatatgacggatttgcagaggaaatttctcggcttagg cgatacctagaaaacctcatacaagaaattaaaacagagctggatttaagcattgcattatat TGAAAAACGACCTTCT GGCCATTGGGTCAGAAAATCATGGTGAACGGTGAGGTTAAGCAACTTCCTAAGGTCTTTAATAGTGAGGAGGAGTTAGTG GAGTTTTTGAAGGAAGTTGTGAACAAGGCGCTCAAGGATCCAGATTATGCGAGTAAGTTCAATGGTGGAGGGAAGGTTGT ACTGACAGTTGATCTTAATTGGAATAAATGTAGAAGGAATCGAAGAGGTCGAATTAGTGTTCCCAAAAGCAAAAGGCTCC TCCAACTACTACCTTAAGACAGCATATCCCACAAGAGGCAACAAAGTTCTCGAATATCGGAAATGGAGCAGAGAATGGGT AGTAACTGGATAGACTACCTATTTCATTTTCCATCGGTATGGAGGTGATAATATGGACACACTTAAACTATCAAGCAAAC ACATCTATATAGAAGCGGATTTAAGGAAGTTTTACGGGGGAGCATATCCGTTTCCTGTTGTTATGTTGGTGGACGGCCAC GTTA