tg0892

Coordinates:829655-830056

>tg0892 hypothetical protein TGAM_0892
MTSSGGFTGKLKTCTRRSSGQKIVDLKTGRVVQIPKVFRDEHELREFLDEVLERALQKEEYYTEFRGQSFVKLRVNLDKL
GMHIDGIDAVEFQFSYNQAKGAYEIITAYPSKGRKVLGYVWDREKQSGRWIYMG

>tg0892 hypothetical protein TGAM_0892
atgacttcctctgggggctttaccgggaagttaaagacctgtacgagaagaagttcaggccagaaaatcgttgacctcaa
aaccgggagggttgtccagatccctaaggtcttcagggacgagcacgagctcagagagttccttgatgaagtactggaga
gggcccttcagaaggaagagtactacacagaatttaggggacagagctttgtgaagctaagggtaaacttggataagctt
ggcatgcacatagatggaatagatgcggtggagttccagttctcatacaaccaagctaagggtgcctacgagatcattac
ggcgtatccctcaaaaggcaggaaagttttagggtacgtgtgggacagagaaaaacaatctggtagatggatatacatgg
gg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 829155 - 830556 (Additional range around tg0892 is :500nt.)

>Thermococcus gammatolerans EJ3 GTGAGCAGGTACGTTTCCTCCCCCCACCCATTCTTTTTGATTTTTACTGTTGATGAGCACTTACTCCTAGGAGCATGCTG GAAAGGAAAAATAGACGGAGCCAACGCAAACATCCATGGATTCTTACAAGAGCTCCTTATAGCGTGCATTCAGATTCTTA ATCCAAAGGAAAGCACTTCCAATTTTGCAAGAAAAGAAGCCATGTGGATGGGATTTGCTCTTAAAGAAGGCAATCCTGCC TATGAAATCATCACATCATCCAATCCATCCAGCATTTATTACCTTGAAGCAGAGGGAAGCACTTTAAAAATTCATTATTA TAACGACTTTCTCTCGTATACTGACTGTCCGGAATTCAAGGGTAAGCATAGGGGTGTCGTTGAAGTTCCTCTCAAAGAGT TCATTGAGGATGTTTTGAAAATCAGCAGGGAGTATCTGGAAAAGTACGCTTCAGTCATCGAGAAAATCAGGCTTGAGCAC GGGGAAGAGCTGGACGATT atgacttcctctgggggctttaccgggaagttaaagacctgtacgagaagaagttcaggc cagaaaatcgttgacctcaaaaccgggagggttgtccagatccctaaggtcttcagggacgagcacgagctcagagagtt ccttgatgaagtactggagagggcccttcagaaggaagagtactacacagaatttaggggacagagctttgtgaagctaa gggtaaacttggataagcttggcatgcacatagatggaatagatgcggtggagttccagttctcatacaaccaagctaag ggtgcctacgagatcattacggcgtatccctcaaaaggcaggaaagttttagggtacgtgtgggacagagaaaaacaatc tggtagatggatatacatgggg TGACTTCAATGAGGTGCAGACTTCGTGGAAAATTCATTGAGATTGAAATAGATATGG AATCCTTTGAGCCAGAACCATTTCCCGGCCGTTTTCCTATTCTTTTTTTGGTGGCTGGGCATGAAGTAGGGGGATACCCC GATGAGGGATGGCTTGGCGACTTATATGCTCTCTTTCAGGATCTACTTCTCTGTACTAGAGATCTCCTGAAGTACCCTGA AAGTTGTTTTAACAAAAGGAAAAACGCTGAGAATGACGGTTTTGATTTATTGCCTGATAGCTATGTCTGCGGGCCAATAC TTGACCTTGATTTTAACACGTATTATCTCGAAAGAAAAGGGGAATTGTTGCGTTTTCATTTCATAAATGAGGCTCCCAGA TACATTTCCTCAAAGAACCCTCTTCAGGGCACCATTGAATTACTGTTTGAGGCCTTCGTCGCCGATATTCTCAAAATAAG CGAGGAGTACCTTGAAAAATGCTTCCCAATAGAAATGGAGATT