tg0893

Coordinates:829986-830600

>tg0893 hypothetical protein TGAM_0893
MWVTLKGKHLTVKIDVSRYVSSPHPFFLIFTVDEHLLLGACWKGKIDGANANIHGFLQELLIACIQILNPKESTSNFARK
EAMWMGFALKEGNPAYEIITSSNPSSIYYLEAEGSTLKIHYYNDFLSYTDCPEFKGKHRGVVEVPLKEFIEDVLKISREY
LEKYASVIEKIRLEHGEELDDYDFLWGLYREVKDLYEKKFRPENR

>tg0893 hypothetical protein TGAM_0893
atgtgggttacactgaaggggaagcacttaaccgttaagatagacgtgagcaggtacgtttcctccccccacccattctt
tttgatttttactgttgatgagcacttactcctaggagcatgctggaaaggaaaaatagacggagccaacgcaaacatcc
atggattcttacaagagctccttatagcgtgcattcagattcttaatccaaaggaaagcacttccaattttgcaagaaaa
gaagccatgtggatgggatttgctcttaaagaaggcaatcctgcctatgaaatcatcacatcatccaatccatccagcat
ttattaccttgaagcagagggaagcactttaaaaattcattattataacgactttctctcgtatactgactgtccggaat
tcaagggtaagcataggggtgtcgttgaagttcctctcaaagagttcattgaggatgttttgaaaatcagcagggagtat
ctggaaaagtacgcttcagtcatcgagaaaatcaggcttgagcacggggaagagctggacgattatgacttcctctgggg
gctttaccgggaagttaaagacctgtacgagaagaagttcaggccagaaaatcgt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 829486 - 831100 (Additional range around tg0893 is :500nt.)

>Thermococcus gammatolerans EJ3 AAAGAGATCACCCTAACGGTCAACGTCAACGGGGAACTCAAAACAATAAGAGTCATAATGCAAGGGGGTAACGAAAGGAG TGGGCTGATCCACGCCTATCTCAGGCACGTGAGGGGGTACGAGATGGAGGACGCAGGAATAACGACCTTCTGGCCGTTGG GTCAGAAGATCATAGTGAACGGCCGGGCTAAGCAGTTGCCGAAGGTATTCAGGAACGAGGAGGAGCTGGTGGAGTTTTTG AAGGAAGTCGTTGAAAGAGTAAGCAAGAATCCTGAGTACGTGTCTGAGAAGTTCTTTAAAAATGGGGTTCCCAAAACAAC GGTAGAATTAGAATTCCCCTTAGAGAAGTTTGGGATCAAAATAGACGGAATAGACCAAATACATTTAAGCTTTAGTTTTG AGGATGGGGAGTTTGTGCTTAAGACAGCGTATCCAACGAAGGGCTGGGCGGTTGAGACGTTTATTCCTGGCAGGGGTGGC TGGCAGTGAGGTGGTTAGA atgtgggttacactgaaggggaagcacttaaccgttaagatagacgtgagcaggtacgtt tcctccccccacccattctttttgatttttactgttgatgagcacttactcctaggagcatgctggaaaggaaaaataga cggagccaacgcaaacatccatggattcttacaagagctccttatagcgtgcattcagattcttaatccaaaggaaagca cttccaattttgcaagaaaagaagccatgtggatgggatttgctcttaaagaaggcaatcctgcctatgaaatcatcaca tcatccaatccatccagcatttattaccttgaagcagagggaagcactttaaaaattcattattataacgactttctctc gtatactgactgtccggaattcaagggtaagcataggggtgtcgttgaagttcctctcaaagagttcattgaggatgttt tgaaaatcagcagggagtatctggaaaagtacgcttcagtcatcgagaaaatcaggcttgagcacggggaagagctggac gattatgacttcctctgggggctttaccgggaagttaaagacctgtacgagaagaagttcaggccagaaaatcgt TGAC CTCAAAACCGGGAGGGTTGTCCAGATCCCTAAGGTCTTCAGGGACGAGCACGAGCTCAGAGAGTTCCTTGATGAAGTACT GGAGAGGGCCCTTCAGAAGGAAGAGTACTACACAGAATTTAGGGGACAGAGCTTTGTGAAGCTAAGGGTAAACTTGGATA AGCTTGGCATGCACATAGATGGAATAGATGCGGTGGAGTTCCAGTTCTCATACAACCAAGCTAAGGGTGCCTACGAGATC ATTACGGCGTATCCCTCAAAAGGCAGGAAAGTTTTAGGGTACGTGTGGGACAGAGAAAAACAATCTGGTAGATGGATATA CATGGGGTGACTTCAATGAGGTGCAGACTTCGTGGAAAATTCATTGAGATTGAAATAGATATGGAATCCTTTGAGCCAGA ACCATTTCCCGGCCGTTTTCCTATTCTTTTTTTGGTGGCTGGGCATGAAGTAGGGGGATACCCCGATGAGGGATGGCTTG GCGACTTATATGCTCT