tg0899

Coordinates:835475-836290

>tg0899 UbiA prenyltransferase family protein
MVAMASISAVVRNLRPLEGRAYIALIGFALLMNWRSAEVYELVTAFLAGVLFVWYAFSINNCFDVDTDSKNPVKVKKNPI
ASGELSFSEGLAISALLAVTGLGLALTTNGTAFAVYVAMLILATLYSAPPRLKARPVVDVLSHGLFFGGLPFIYGALIDG
NLSEAEILMATGITLYSFALELRNHLSDYESDLRAGLRTTPIVIGKGRSELLVEVFSVLALAVTLYTLKPHLIIASSLMF
AGRGLRVDQRTVYRMFDVAMVGAVLAAGGTAL

>tg0899 UbiA prenyltransferase family protein
gtggtagcgatggcatcgatttcagccgttgtcagaaacctccggccactggaggggagggcatacatagcactgattgg
gttcgcccttctgatgaactggaggagtgccgaggtatatgagctcgttacagcgttcctggcgggagtcctcttcgtgt
ggtatgcgttctcgataaacaactgcttcgacgttgatacggattctaaaaatccagtgaaggttaagaagaaccccata
gcctctggagagctgtcgtttagtgaagggctggcgatatctgctctgctcgcggtgacggggctcgggcttgcactaac
cacaaatggaaccgcgtttgcggtttacgttgcaatgctaatcctcgccacactctattcggccccaccgaggcttaaag
cgaggcccgtagtggatgtgctgtcccacgggctgttcttcgggggtctgcccttcatctacggggcgctcatcgatggg
aacctttcagaggcggaaatcctgatggctacggggataaccctctactctttcgccctcgagctgaggaatcacctctc
ggactacgagagcgacctaagggctggactcaggacaaccccgatagtcattggaaaaggaaggagcgagctcttagtgg
aggttttctcagtcctcgccctcgcggtaactctgtacaccctcaagccccacctgataatcgcctcctccctgatgttc
gcggggcgcgggctgagggttgatcagagaacggtctaccgcatgttcgacgtggcaatggttggggcagttttagcggc
tggagggacggcatta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 834975 - 836790 (Additional range around tg0899 is :500nt.)

>Thermococcus gammatolerans EJ3 CGTAACTACCACCCCAGTAGTTAACTACTGGGGCAGAAGTTATAAGGGTTTTGACGTTCCAAAGCTTGGAGAAGGAAGTT GCATGAGGTTTAACCCTTCAGCTTCAGCTCACCTTCCTTCTCTATGGCCTTTAGCGTGGACTCCAGCCTGCTGAAGAGCG CTTGGAGAGCCTCCCTGGGGGCCTTGGCGTAGTAAACGTAGCCCAGCCAGCCCCTGTTCACGAGGGTTCTCTCGACGAGG CCCAGCTCGAGGAGGTGCTTAAGCTTTTCCCTTACAATCCTTTCAGATAGGCCGAGCGTCTTTGCAATCTGCCTCGGCGT AAGCGCCTCCCGCTGGAGGAGGGAGTAGATTTTTATCTCGGACTCCCCGAGCTCAAAGACCCTGAGGGTTTTGGACAGGG CTCGGAGTATCTCCTCCATTCCAATCCCCTGAAGATTTTTCTTCATACCTGTCTACAACTTTGTGAAAAGGTTTATAACA CTTTCTTCAAAGGGTGAGCG gtggtagcgatggcatcgatttcagccgttgtcagaaacctccggccactggaggggag ggcatacatagcactgattgggttcgcccttctgatgaactggaggagtgccgaggtatatgagctcgttacagcgttcc tggcgggagtcctcttcgtgtggtatgcgttctcgataaacaactgcttcgacgttgatacggattctaaaaatccagtg aaggttaagaagaaccccatagcctctggagagctgtcgtttagtgaagggctggcgatatctgctctgctcgcggtgac ggggctcgggcttgcactaaccacaaatggaaccgcgtttgcggtttacgttgcaatgctaatcctcgccacactctatt cggccccaccgaggcttaaagcgaggcccgtagtggatgtgctgtcccacgggctgttcttcgggggtctgcccttcatc tacggggcgctcatcgatgggaacctttcagaggcggaaatcctgatggctacggggataaccctctactctttcgccct cgagctgaggaatcacctctcggactacgagagcgacctaagggctggactcaggacaaccccgatagtcattggaaaag gaaggagcgagctcttagtggaggttttctcagtcctcgccctcgcggtaactctgtacaccctcaagccccacctgata atcgcctcctccctgatgttcgcggggcgcgggctgagggttgatcagagaacggtctaccgcatgttcgacgtggcaat ggttggggcagttttagcggctggagggacggcatta TGAAGAAAAGAACCCTCCTTTCAGTCCTCGCCCTCCTGTTCT CGGTAGGCTACATTGCCCATACAATAGAGGTGGAGGAACTGGGGGAGGCAATCTCGACGGCCGACCCGAGGTTTCTCCTC CTGGCTTTTGGGATGGCGTTTTCGGCTATACTTGTCTCAACTCTGAGGTGGTACATCGTCCTCAGAAAGCTCCAGAAGAC GAGCTTCAGGAAAACCTTTACCGCAATTCTGAGCGGTTTCTACATGATGGCCTTCCTCCCCCCGAGTGTGGGGCACGTTG CCAAGGTGAAGCTCGTCGGAGGGGACTACTTCAAAGCATTGTCCGCCCTCGCCTTCGGGATTTTCCTGGAGGTTCTAATC ATCGCCGGTATCTCCCTCCTCGTATTCGGCGCCACCAAGTGGGGTATCTTTCTGCTTGGGATTCTCTCCCTAATCCTGTT CTACGATAAAGGAGCCTATGCACTCCTCAACGGGGGGATTGCCGTAATCCAAAGGCT