tg0903

Coordinates:838956-839357

>tg0903 Glycine cleavage system protein H (gcvH)
MIEVGEYKVKEGLYYTKDHEWAKVLDDGTVLVGITDYAQKELGDLAYVELPEVGKEVNKGDVLCEIESVKAVSEVYAPVS
GEVIEVNEALEDSPELLNEDPYENWIAKLKPSNLDEELKELMDAEAYAKYLESL

>tg0903 Glycine cleavage system protein H (gcvH)
atgatcgaagtcggcgaatacaaggttaaggaaggcctctactacacgaaagaccacgagtgggccaaggttcttgacga
cggaaccgttctggttggtataacggactacgcccagaaggaactcggcgacctcgcctacgtcgagcttcccgaggtcg
gtaaggaggtcaacaagggcgacgtcctctgtgagatagagagcgtcaaagctgtcagcgaggtctacgccccggtcagc
ggagaggtcattgaggttaacgaggcccttgaagacagccccgagctcctcaacgaggacccctacgagaactggattgc
caagctcaagccgagcaacctcgatgaggagctcaaggagctcatggacgctgaggcctacgcgaagtacctggagagcc
tc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 838456 - 839857 (Additional range around tg0903 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTCTGAAGCACGAGTTCGAGCGGGCCGTCCTGATTTATCAGCTGGAGTTTGCCGAGAGGATGATTGCGAAACCGGGCGA CCGAAACTACTCCCGCCTCTCTCTGATGGTTCAGGCGAAGGCCAACGTCGAGCTCGTTGAAAGGATCGGCAGAGGTGCGT TCTGGCCCAGACCAAAGGTCGATTCCGCGGTTGTTGTTCTCGAGCCCAAACCGGAGAAGGAGAGGATAGAACTGAACGAA AACCTCGTTAAGGCCCTCTTTCAGCACAGGAGAAGCACCGTTGCATCCGCCCTCAAAAAGTCCGCCCATATGCTCGGGAC CGACAAAAAATCTATCAAGGACTACCTCTCCTCGCTCCCCCACGCGGAAAAGCGTGTCTTCCAGCTCTCTCCAGAGGAGG TCCTTGACATTGAGGTTTACCTTCGAGACAACGGCCTGCTTTCTCAAAAACCGGAGAAAGGTTTAAATTGAATTCATTGA AGAACTTCCGGTGATGTTC atgatcgaagtcggcgaatacaaggttaaggaaggcctctactacacgaaagaccacgag tgggccaaggttcttgacgacggaaccgttctggttggtataacggactacgcccagaaggaactcggcgacctcgccta cgtcgagcttcccgaggtcggtaaggaggtcaacaagggcgacgtcctctgtgagatagagagcgtcaaagctgtcagcg aggtctacgccccggtcagcggagaggtcattgaggttaacgaggcccttgaagacagccccgagctcctcaacgaggac ccctacgagaactggattgccaagctcaagccgagcaacctcgatgaggagctcaaggagctcatggacgctgaggccta cgcgaagtacctggagagcctc TGAGCTTCCAACTTTTCTTCCTCCTTTCGGAATCCTTAAGTATCTAAAGAGCCCACA AACTTTGGTGGTTTCCATGAAGGTTCTGAAGGAATGGGACGTTAAGGTGAAGCTTGTAAGGACAAAGAGGGGAGCGATTC TCCACATGATTGAGCTTGAACCCGGGCATTTCTACCTCGAACAGAACCCCCTCAAGGACTCCAAGTACGGCGTCGCCTAC AGGAAGATAAAGGAGCACTTCCCCGAGTTCTACATGTTCTGGGAGATTAAGAACAACCGCTACACCGGAAAGCTCCTCGC CGGGGCGTTTTTAGAAAAGCAGGAGATAGATGACTTCATAACGCTGTTAGCACAAAGCGAGGACTTCAAGAAGTTCGAGG AAATCCTTGAGGAAATTGAGGAGCTTGAAGAGGAGTGAGCTCAGCCCTTGGTTCTCATCATTTTTGCCGTGTAAGTCACG GACTCAGATACCCTAGAGGTCGTCATCGCTCGCTTCTCTTCAA