tg0904

Coordinates:839389-840222

>tg0904 Ribosomal RNA adenine methylase transferase (Dimethyladenosine transferase) (ksgA)
MRDRLFSIIYKYNLRPNRTLGQNFLIVPDIIERNVKRAELSEKDTVLEIGPGLGVLTDELSKKAGKVYAIEADSRMIEIL
QREYSWPNVELIKGDAVKVEWPEFNKMVSNLPYQISSPVTFKLLKHEFERAVLIYQLEFAERMIAKPGDRNYSRLSLMVQ
AKANVELVERIGRGAFWPRPKVDSAVVVLEPKPEKERIELNENLVKALFQHRRSTVASALKKSAHMLGTDKKSIKDYLSS
LPHAEKRVFQLSPEEVLDIEVYLRDNGLLSQKPEKGLN

>tg0904 Ribosomal RNA adenine methylase transferase (Dimethyladenosine transferase) (ksgA)
atgagggatcgtctcttctccattatttataaatacaaccttcgcccgaacagaaccctcggccaaaactttctgatagt
gcccgatatcattgaaagaaacgttaaacgggcggaacttagcgaaaaagatacagttctcgaaatagggcccggtctgg
gtgttctaacggacgagctctccaaaaaggccggaaaggtgtacgcgatagaagccgacagcagaatgatcgaaatcctc
cagagggagtactcctggccgaatgtggaactcatcaagggcgacgccgtcaaagtcgagtggcccgaattcaacaagat
ggtctccaacctcccataccagatttcctcacccgttacgttcaagcttctgaagcacgagttcgagcgggccgtcctga
tttatcagctggagtttgccgagaggatgattgcgaaaccgggcgaccgaaactactcccgcctctctctgatggttcag
gcgaaggccaacgtcgagctcgttgaaaggatcggcagaggtgcgttctggcccagaccaaaggtcgattccgcggttgt
tgttctcgagcccaaaccggagaaggagaggatagaactgaacgaaaacctcgttaaggccctctttcagcacaggagaa
gcaccgttgcatccgccctcaaaaagtccgcccatatgctcgggaccgacaaaaaatctatcaaggactacctctcctcg
ctcccccacgcggaaaagcgtgtcttccagctctctccagaggaggtccttgacattgaggtttaccttcgagacaacgg
cctgctttctcaaaaaccggagaaaggtttaaat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 838889 - 840722 (Additional range around tg0904 is :500nt.)

>Thermococcus gammatolerans EJ3 AGACAGGCAGGCGAACAGGCAAGCCCGTTGCACAGGTTATAGGGGAGAAAGCTTTCACGCTCCTGGAGGTTACCCCCAAG GTAGATTTAATGCTCTATGAGAGGGTCTTCATAGGCAAAGGAAACCGCGACAAGGTTCTCATGATAAACAGGAAGATAAG CTACGACGATCTGACCGCGACGGCCAAGGCCGAGCTTCCGTACGTCGTTAAGGAGATCGTCAAAAACAATGAGAACAGAT TTGTAAAGTTCTTCAACATCGCCCCCCCAATAACCAACAGACTCCACAGCCTTGAACTACTGCCAGGCATAGGAAAAAAG CTGATGTGGGAGATCCTCGAAGAGAGAAGAAAAGAACCGTTCAAGAGCTTTGAGGACCTCAAATCGAGGGTTAAGGGCCT TCACGACCCCTGCGAGATGATCGCCAAGAGAGTGATTGACGAACTCCAGGGGAAGGACAGGTACAGGCTCTTCGTGGGAT CAAGGAGGCTCTTCAGAGA atgagggatcgtctcttctccattatttataaatacaaccttcgcccgaacagaaccctc ggccaaaactttctgatagtgcccgatatcattgaaagaaacgttaaacgggcggaacttagcgaaaaagatacagttct cgaaatagggcccggtctgggtgttctaacggacgagctctccaaaaaggccggaaaggtgtacgcgatagaagccgaca gcagaatgatcgaaatcctccagagggagtactcctggccgaatgtggaactcatcaagggcgacgccgtcaaagtcgag tggcccgaattcaacaagatggtctccaacctcccataccagatttcctcacccgttacgttcaagcttctgaagcacga gttcgagcgggccgtcctgatttatcagctggagtttgccgagaggatgattgcgaaaccgggcgaccgaaactactccc gcctctctctgatggttcaggcgaaggccaacgtcgagctcgttgaaaggatcggcagaggtgcgttctggcccagacca aaggtcgattccgcggttgttgttctcgagcccaaaccggagaaggagaggatagaactgaacgaaaacctcgttaaggc cctctttcagcacaggagaagcaccgttgcatccgccctcaaaaagtccgcccatatgctcgggaccgacaaaaaatcta tcaaggactacctctcctcgctcccccacgcggaaaagcgtgtcttccagctctctccagaggaggtccttgacattgag gtttaccttcgagacaacggcctgctttctcaaaaaccggagaaaggtttaaat TGAATTCATTGAAGAACTTCCGGTG ATGTTCATGATCGAAGTCGGCGAATACAAGGTTAAGGAAGGCCTCTACTACACGAAAGACCACGAGTGGGCCAAGGTTCT TGACGACGGAACCGTTCTGGTTGGTATAACGGACTACGCCCAGAAGGAACTCGGCGACCTCGCCTACGTCGAGCTTCCCG AGGTCGGTAAGGAGGTCAACAAGGGCGACGTCCTCTGTGAGATAGAGAGCGTCAAAGCTGTCAGCGAGGTCTACGCCCCG GTCAGCGGAGAGGTCATTGAGGTTAACGAGGCCCTTGAAGACAGCCCCGAGCTCCTCAACGAGGACCCCTACGAGAACTG GATTGCCAAGCTCAAGCCGAGCAACCTCGATGAGGAGCTCAAGGAGCTCATGGACGCTGAGGCCTACGCGAAGTACCTGG AGAGCCTCTGAGCTTCCAACTTTTCTTCCTCCTTTCGGAATCCTTAAGTATCTAAAGAGCCCACAAACTTTGGTG