tg0905

Coordinates:840222-840839

>tg0905 hypothetical protein TGAM_0905
MDYTRRHPYRESLQKKRHNKEYEEYAYVLDYLPEGYTDLKTGRRTGKPVAQVIGEKAFTLLEVTPKVDLMLYERVFIGKG
NRDKVLMINRKISYDDLTATAKAELPYVVKEIVKNNENRFVKFFNIAPPITNRLHSLELLPGIGKKLMWEILEERRKEPF
KSFEDLKSRVKGLHDPCEMIAKRVIDELQGKDRYRLFVGSRRLFRE

>tg0905 hypothetical protein TGAM_0905
atggactacacaagacgtcatccctatagggaaagcctccagaaaaagaggcacaacaaggagtatgaggagtacgcata
cgtgctcgattaccttcccgagggctacactgatctgaagacaggcaggcgaacaggcaagcccgttgcacaggttatag
gggagaaagctttcacgctcctggaggttacccccaaggtagatttaatgctctatgagagggtcttcataggcaaagga
aaccgcgacaaggttctcatgataaacaggaagataagctacgacgatctgaccgcgacggccaaggccgagcttccgta
cgtcgttaaggagatcgtcaaaaacaatgagaacagatttgtaaagttcttcaacatcgcccccccaataaccaacagac
tccacagccttgaactactgccaggcataggaaaaaagctgatgtgggagatcctcgaagagagaagaaaagaaccgttc
aagagctttgaggacctcaaatcgagggttaagggccttcacgacccctgcgagatgatcgccaagagagtgattgacga
actccaggggaaggacaggtacaggctcttcgtgggatcaaggaggctcttcagagaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 839722 - 841339 (Additional range around tg0905 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGACGGCGGCAAGGTTAAGACATTCTTCATACACCCGGTCCACCTCAGGCCCCAGAAGGGATGAGCATGATCGGGAGAA AAAAGCTGGAGGAACACTACGTCACGCTGGCAGAAGCCAAAGAACTCCTCGAAAAGCGCAGAGCAGAGGGGATGGAGGAG AATCCCGAGGAGCCCATGTTCTACGAGGCCAGGATCAGCCTTGAACACGCGGAACGCTTTGCCAAACTGAAGCCAGAGCA GGCTAGGGAGCTCAAGGAGAAGCTGATGAACCTCTTCGACTGGATCGACGAGAGAATCGCGGCCAAGCTTGTCGACCTCC TCCCAGAGGACTACTTTGACATCAGGGTTATCTTCGCCAAGGAGGAGCACATGCCCACCAAGGAAGAGGCCGAGGAGATT ATCAACCTGATAGACGAGTACAGACCCCTCGAGTAACTCTTCTATTTTTCTTCACAAAGTATAAAAACTTCTGGAGAGTA AATTTCTGGGGGAGAGAAG atggactacacaagacgtcatccctatagggaaagcctccagaaaaagaggcacaacaag gagtatgaggagtacgcatacgtgctcgattaccttcccgagggctacactgatctgaagacaggcaggcgaacaggcaa gcccgttgcacaggttataggggagaaagctttcacgctcctggaggttacccccaaggtagatttaatgctctatgaga gggtcttcataggcaaaggaaaccgcgacaaggttctcatgataaacaggaagataagctacgacgatctgaccgcgacg gccaaggccgagcttccgtacgtcgttaaggagatcgtcaaaaacaatgagaacagatttgtaaagttcttcaacatcgc ccccccaataaccaacagactccacagccttgaactactgccaggcataggaaaaaagctgatgtgggagatcctcgaag agagaagaaaagaaccgttcaagagctttgaggacctcaaatcgagggttaagggccttcacgacccctgcgagatgatc gccaagagagtgattgacgaactccaggggaaggacaggtacaggctcttcgtgggatcaaggaggctcttcagagaa T GAGGGATCGTCTCTTCTCCATTATTTATAAATACAACCTTCGCCCGAACAGAACCCTCGGCCAAAACTTTCTGATAGTGC CCGATATCATTGAAAGAAACGTTAAACGGGCGGAACTTAGCGAAAAAGATACAGTTCTCGAAATAGGGCCCGGTCTGGGT GTTCTAACGGACGAGCTCTCCAAAAAGGCCGGAAAGGTGTACGCGATAGAAGCCGACAGCAGAATGATCGAAATCCTCCA GAGGGAGTACTCCTGGCCGAATGTGGAACTCATCAAGGGCGACGCCGTCAAAGTCGAGTGGCCCGAATTCAACAAGATGG TCTCCAACCTCCCATACCAGATTTCCTCACCCGTTACGTTCAAGCTTCTGAAGCACGAGTTCGAGCGGGCCGTCCTGATT TATCAGCTGGAGTTTGCCGAGAGGATGATTGCGAAACCGGGCGACCGAAACTACTCCCGCCTCTCTCTGATGGTTCAGGC GAAGGCCAACGTCGAGCTC