tg0913

Coordinates:846512-847027

>tg0913 hypothetical protein TGAM_0913
MKLEKLFKAVAGAGVGALLAFIFVVVGIPDLTDVKTVLWIYLLFMIPLGWIFSRSRFNFRTSALSYLSGLGTVFALVLLS
PVVSFGKGAIFIAILISLLIVLYPDPCGVLDVLLSGPLYFAGTITVMAIAGALDLPGNSIGLFMVTVFIGFLGMIGVVTG
AAARLLFAKPKP

>tg0913 hypothetical protein TGAM_0913
atgaagttggagaaactctttaaagccgtagcgggggccggagttggtgcactcctcgccttcatctttgtggtcgtggg
aatccccgacctgacagacgtcaaaactgtactctggatctatttactcttcatgattccactagggtggatcttctcga
gaagccgttttaacttcagaacctccgccctgagctatctatccgggctcgggacggtctttgcacttgtcctcctttcc
ccagtcgtcagctttggcaagggggcaattttcattgctatactgatttccctgctgatagtcctttaccccgacccctg
cggtgtcttggatgtccttctctccggtcccctctacttcgctggaacaataacggtaatggccatagctggcgccctag
atctcccagggaacagcataggcctttttatggtaaccgtcttcataggtttcctcgggatgataggtgtggttaccggt
gccgccgcgaggctgctcttcgcaaaaccgaaacct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 846012 - 847527 (Additional range around tg0913 is :500nt.)

>Thermococcus gammatolerans EJ3 GGGAGGGCCTGATCTCCAGGGAAACTTCCGGCAGAAAGACACGTCTTGGCCTGACAGAAAAGGGGCTGGAAATCCTCGAA GAGCTCCACGAAAGGCTTGAAAAGGCCCTCTACTGCGGCCTCATCATCGGAGAGGTTGTCTCGGGCCTCGGAGAGGGCTC ATACTACGTCCGGCTTTACAGGGACAGGATAAGGGAGTACCTCGGCTTCGATCCATTTCCGGGGACGTTGAACGTGAAAG TGCTCTTTCCCCGGACAATATTCGACGCCCTAATTGATGTTAGACCAATCCTCATCCCCGGCTTCGTTCGGGACGGCAGA ACCTTCGGAGACGTTAAGGCTTATCCAGTGAGAGTAGAGGATGTAGAGGGGGCTATCGTGGTTCCCTCCCGGAGCGTTCA TCCACCAAAGATAGCTGAGATAATAGCCCCTGTAAACCTCAGGGAAACCCTCAACCTGAGGGACGGTAGTAGGATCAGGA TAAAGGCTGTGGGAGGTAG atgaagttggagaaactctttaaagccgtagcgggggccggagttggtgcactcctcgcc ttcatctttgtggtcgtgggaatccccgacctgacagacgtcaaaactgtactctggatctatttactcttcatgattcc actagggtggatcttctcgagaagccgttttaacttcagaacctccgccctgagctatctatccgggctcgggacggtct ttgcacttgtcctcctttccccagtcgtcagctttggcaagggggcaattttcattgctatactgatttccctgctgata gtcctttaccccgacccctgcggtgtcttggatgtccttctctccggtcccctctacttcgctggaacaataacggtaat ggccatagctggcgccctagatctcccagggaacagcataggcctttttatggtaaccgtcttcataggtttcctcggga tgataggtgtggttaccggtgccgccgcgaggctgctcttcgcaaaaccgaaacct TAAATACGATTGAAAAGCAGAAT TCAGGGGGTGGTTTAAATGGTCATGAGACTGTCGAGGATATACGGAAAGCAGATCTACAACACAAAGGGGAACTACGTTG GTTACGTTGACGAGGTTTTGATAGAGATAGACACGGGCTACGGAAGGGTTCTCGCCCTCGCACTTCCGGGAGAAAAGGTT GGAATACCCTACGAGCGTGTTATTGCAATAGGCGACATAATCCTCGTCAAGGCTAAGGAGGACTGAACTGCCTCTCTTTA TTCCGCTACATTTCTAGGTACTCTCTGTAATGCTCAACGCTAAAGACCCGATATGGCTCCAAAGGTTCATCTGAGGGAGT ATCCGAGGATTCTACGGAAGATTGAACTTTCTGGAGGGATTTGTCATCAAACTCCATGCTTTTTATTACCCTATCAAATC GAACCACGAGTTCTTTAACAGTTGGAGGTTCGGTCTTCAGTGGTCTCGTCTTCTTGGGATCATCTATCAAAAGAGCC