tg0928

Coordinates:862001-862654

>tg0928 hypothetical protein TGAM_0928
MMKKVVPLVILVVALSLVAAGCVSVEEHVKVSSDGKIALLKMAINMSRDVYSLALSNTSEGSFCADFRENLTDYEKEHFT
CEEKVSGETATIVITGKDIDPSKLTGDTKMKVEKQGDYIEFWDYTWYEEGKKEEKNETDWDKEIASLFTIDYYLEMPGEI
VDSNAQVVNGNKAEWHWNLYVASKRPIYAKAKVEEKKGLCGPAFLVGLAIVPLLLRRR

>tg0928 hypothetical protein TGAM_0928
atgatgaaaaaagtcgtaccattggttatcttagtcgttgccctttccctcgttgctgccggctgtgtgtccgttgagga
gcacgtgaaggtaagttccgacgggaaaatagcgctcctcaagatggccatcaacatgagcagggatgtgtactctctcg
cgctctccaacaccagcgagggctccttctgcgcggacttcagggagaacctgacggattacgagaaggagcactttacc
tgcgaggaaaaggtttctggggagaccgcgacgatcgtcataaccggaaaggacatagacccatccaagctcacgggaga
cactaaaatgaaagtggagaagcagggcgattacattgagttctgggactacacctggtacgaagagggcaaaaaagagg
agaaaaatgaaaccgactgggataaagagatcgcaagccttttcacgatagactactaccttgaaatgccgggagagatc
gttgattccaacgctcaggtggttaacgggaacaaggccgagtggcactggaacctttacgtggcctcaaagcgtccgat
ctacgccaaggcaaaggttgaggagaagaagggtctctgcggtccggctttcctcgtgggtctggcaatagtgccgcttc
tcttacggaggcgt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 861501 - 863154 (Additional range around tg0928 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGTCCACTTCCCTTGGCTTGACGCGCATCTTGCTCTTCACGAAGTCTTCGACTGGGTCTATCTCTGCGAGCTGGATTTT CTCCTTCTTCGTCTGCGCGGCCGCCCTGGCGAGCTTGTAGGCCTCTTCAATCTTCTTCTCAAGGTTCTCAAGCTCGCTCG TCGAGGCAAAGCCCCAGGCACCGTCCGCCAGAACCCTTATGGCAACGCCCCTGTGGAGCTTCCCCGTGAAACTCGTAAAG ACGCCGTCCTTGAGGCCGAGCGTGGTCTTCCTTAAGTCCTCGTAGCGCAGCTCGATGTACTCGGCCTTCAGGTTTTCTTC AGCCCACTTAAGGGCCCTTTCAAGTGCCTCCATGTCCACCACCGTTGACCTTTGTCCAATCTCTTGTGAGAGGGGCAACT ATAAAAGCCTTTTGAGCCTTTCGATGAGCATCTAAGCATAGTCAGGACATTGGGGAATAAAGTTTTTAATGAAGTAAGAA CCTAGAACACTGGGGATGCT atgatgaaaaaagtcgtaccattggttatcttagtcgttgccctttccctcgttgctgc cggctgtgtgtccgttgaggagcacgtgaaggtaagttccgacgggaaaatagcgctcctcaagatggccatcaacatga gcagggatgtgtactctctcgcgctctccaacaccagcgagggctccttctgcgcggacttcagggagaacctgacggat tacgagaaggagcactttacctgcgaggaaaaggtttctggggagaccgcgacgatcgtcataaccggaaaggacataga cccatccaagctcacgggagacactaaaatgaaagtggagaagcagggcgattacattgagttctgggactacacctggt acgaagagggcaaaaaagaggagaaaaatgaaaccgactgggataaagagatcgcaagccttttcacgatagactactac cttgaaatgccgggagagatcgttgattccaacgctcaggtggttaacgggaacaaggccgagtggcactggaaccttta cgtggcctcaaagcgtccgatctacgccaaggcaaaggttgaggagaagaagggtctctgcggtccggctttcctcgtgg gtctggcaatagtgccgcttctcttacggaggcgt TAAGGGGTTCTTTCCTTTAATCTTTGCCTTCAAAATAATGACCT CTTTCATTGAAAGGACGTCTTTTCGTGTTCTTTGACTTTGATTGATTTGCCTCTTTATTTAGATATTAGTCGAAACGCTA AGCTTTTATACGAAAAGAGCCGATTTATCTTGGTGGTTTCTATGGCCAAAGGGCTGGGTATTAAAGACATCGGAAAGTTC AAGCTCGTTGGGAACATCGACGCCTTCGGGAGAAGGCTTGTTTTCCAGGTCACGGAAATAAGCGTCGAGAAGGACGACTA CTTCTCAAAGCTTTACCTCTACGACGGCAGGAAAGTTAAGCCCTTCACCTCCGGAAAGAAGGACGGAAACCCGCGCTTCT CCCCGGACGGAAAGCTGATAGCCTTCACCTCCAAGCGCGATAAGGAGAGCAAGGAGGCCGAGCTGTATGTTATTCCGACC GACGGCGGCGAGGCGAGGCTTTTAACGAAGTTCAAGTACGGGATTAAGAACCTCC