tg0934

Coordinates:868037-868624

>tg0934 Molybdopterin-guanine dinucleotide biosynthesis protein A, putative (mobA)
MLGLILAFPEKRWENYTLPVKGEPIVRLTERRLLTAKRINKTLTIVRKDKLKTYSLHVSNPVPVTARNKMEALLRALPDE
PFFLVEGNMPLIMPFFVNYLVGLFYEDEPEALIPVWSDGSAEVFHAVYEADALREAIESAMAEGYRSFSRITEFLDYESV
SIEELARRNPKVTLSFFRVRSGFDAKFADESLRSGV

>tg0934 Molybdopterin-guanine dinucleotide biosynthesis protein A, putative (mobA)
atgctcggcttaatcctcgcgtttcccgaaaagcggtgggaaaactacaccctgcccgtgaaaggagagcccatcgtcag
gctcacggagaggaggctcttaaccgccaaaagaataaacaaaacgcttacaatcgtcagaaaggacaagctgaagactt
actcgctccacgtttcaaaccctgtccccgtgactgcaagaaacaagatggaggcgctcctcagggcacttcctgacgag
ccttttttccttgtcgaaggcaacatgccccttataatgcccttcttcgtgaactatctcgtcggtctcttctacgagga
cgagcccgaggcgctaatccccgtctggagcgatggaagtgctgaggtattccacgcggtttacgaggcagatgcgctga
gagaggcaatagaatcggcaatggcagagggatacaggagcttttcaaggattacagagttccttgattacgagtcagtt
tcgattgaagagctggcaaggaggaaccccaaggtaacgctgagcttcttcagggtgaggagtggcttcgacgcgaagtt
tgcagatgaatcgcttaggtctggagtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 867537 - 869124 (Additional range around tg0934 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCGGGTGGAGCGCCTTGATGACCCTTCCTATGAGCACGAAGAGGGTTCCTGCGATAATCGGGAGCTCGTTGACGACGTC CTCCTCGAGCGGGATGTCTCCGGGTATCTTCTTCAGCAGGAACTTCCTGATTGGCTCGATCTGGACTTTCTCGTCCTCGA TGACCGCCCTGAAGAGGTTCAGGCTGTTCTTGAAGCCCTTGGTAATCGGTATGTGACGCATCTTTATCGTATCCGAGCGC TCGGCTTTGGCGTTCTCGTAGGCGACCTCGAAGAGATCTGCCAGCTTCTTTTCGACTATCTCCATCATCTCCTCGGCCCT CGGCTTGATGACCGCGAGCTCGCAGGTCCTCTCCAGGATCTTCTGGAGCTGCGGGTAGGGTATTATCATCTCGGCCATCT CTCATCACCTCCGTGTTCTTGCCGATGAATTTTAGTAACCCAGAGTATATAAAACTTTCGGGGGCGGGAGATTTTTAAAG AGAATCCTTTAGTTCGCACT atgctcggcttaatcctcgcgtttcccgaaaagcggtgggaaaactacaccctgcccgt gaaaggagagcccatcgtcaggctcacggagaggaggctcttaaccgccaaaagaataaacaaaacgcttacaatcgtca gaaaggacaagctgaagacttactcgctccacgtttcaaaccctgtccccgtgactgcaagaaacaagatggaggcgctc ctcagggcacttcctgacgagccttttttccttgtcgaaggcaacatgccccttataatgcccttcttcgtgaactatct cgtcggtctcttctacgaggacgagcccgaggcgctaatccccgtctggagcgatggaagtgctgaggtattccacgcgg tttacgaggcagatgcgctgagagaggcaatagaatcggcaatggcagagggatacaggagcttttcaaggattacagag ttccttgattacgagtcagtttcgattgaagagctggcaaggaggaaccccaaggtaacgctgagcttcttcagggtgag gagtggcttcgacgcgaagtttgcagatgaatcgcttaggtctggagtt TAGCAACCATAACGTTTAAGGGCCCTCCGC TGGAGTTTCCCCGGTGGTTGAGTTGAAGGGTGCGTACCTCGCGGCGATAACGCTCATGCTGCTCTTCTCTACCTTAGCCG GTGCCTCCGACTACTGGGTGGGCTTCTACGGCACGACCGGCTACGATGAGCTCAGGGCCGTTTCCATAATGCCGAACGGG GACATCGTGGCCGCTGGAAAGGCTTCTTTTAACGGTACAACCGCTCCCTGGGTGATACGGCTCGACCGTTACGGGAGGGT TCTGTGGTCGAAGTACTACACGATCCCGGGCGTGGAGGCCGATGTGAGGGCTCTTGCCATCGATAACAACGGTAACATCA TAGCGGTTGGATCCGTCAGGAGGAAAGCAGGTGAAACGCTGACCTCTGACCTTCTCGTCATGAAGCTCGACGGAGACGGA AACGTCCTTTGGGCGAGGGATTACGATGCAGGATCGCTTGAAGTTGCCAGTTCGATTGTGATTGACGGC