tg0939

Coordinates:876075-876353

>tg0939 hypothetical protein TGAM_0939
MAVAELCLFPLGTESPSVGRYLEPVIEVIEKSGLKYMVCPMGTVVEGSVDEILELVKKCHEAILKAGAKRVVISLKIDDR
IDKPLSIEGKLGV

>tg0939 hypothetical protein TGAM_0939
atggccgtcgccgaactgtgcctctttcccctcggaaccgaaagcccgagcgttgggaggtacctcgaacctgtcatcga
agtcatagaaaagagcggcctcaagtacatggtctgtcctatggggacggttgtcgagggatccgttgatgagattctcg
agctcgtcaaaaaatgccacgaggctatcctaaaggccggggcgaagcgcgtcgtcatcagcctgaagatagacgacagg
attgataaacccctcagcatagagggtaagctgggggtc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 875575 - 876853 (Additional range around tg0939 is :500nt.)

>Thermococcus gammatolerans EJ3 ACACGATAGTAAACACCCTGATAATCTCCCGCCTGAGGCGTCAGAGGGAAAACTTCATACTGGACGGGTATCCGAGAACG CCCGAGCAGGTTATAGCCCTTGAGAACTACCTCTACGACCACGGGATAAGGCTCGATCTGGCACTGGAGATATTCATCGA TGAGGATACCAGCGTTGAGAGAATCTCCGGCAGGAGGATATGTCCGAACTGTGGGGCAGTTTACCACATCACCTACAACC CGCCAAAGGTTCCGGGGATCTGCGACGTCTGTGGAACAAAGCTCATACAGAGAACCGATGATAGGGAGGAAGTCGTAAGA AAGCGCTACCGGATCTACATCAAAAACATGGAACCGATAATAAAGTTTTACAGGGCAAAAGGCATCTACGTCCGCGTTGA CGGGGATGGCCTCATCCCGGACGTATGGAAAAGGATAAAACCCCTCCTCGACTACATCCACGAGAGGGAAAAGAAAAGAA AGGAGCACGAGTGATGCCT atggccgtcgccgaactgtgcctctttcccctcggaaccgaaagcccgagcgttgggagg tacctcgaacctgtcatcgaagtcatagaaaagagcggcctcaagtacatggtctgtcctatggggacggttgtcgaggg atccgttgatgagattctcgagctcgtcaaaaaatgccacgaggctatcctaaaggccggggcgaagcgcgtcgtcatca gcctgaagatagacgacaggattgataaacccctcagcatagagggtaagctgggggtc TGAATGGCCGAGTACTTCGA CAGGATCGCGGACAGGTACGACGACTGGTACAGGACGAGAACTGGAAGGTACGTGGACAGGATCGAGAAGTGGCTTGTTT TCTCGATGCTCCGGACGAAATCAGGAGAGGCCCTCGACCTTGGCTGTGGGACGGGCAACTACACCCTCGAACTCAAGAGG AGAGGCTTCGACGTAATAGGCCTGGACGCTAGCGAGGGAATGCTCAGGATAGCCCGCTCAAAGGGCCTGAACTGCATCAA GGGCAACGCCTACAGCCTGCCATTCCCAGACGAAAGCTTTGACCTCGTGCTGAGCGTCACGATGTTTGAGTTTATCCACG AACCCGAGAAAGTTCTTGCCGAGATCTACCGGGTTTTAAAGCCCGGGGGAGAAGTGCTCATCGGCACAATGAACGGTAGA AGCCTCTGGTTCCTTTTCAAACGTCTTAAAAGCCTCTTCATGGAGACTGCCTACCGCTATGCGCGCTTTTACACGCCCAG