tg0941

Coordinates:877091-877534

>tg0941 hypothetical protein TGAM_0941
MKLSTGYVRASGYAHKVRRVLFALTRGKVDPKEVVRAAGELNQYIFERFQELGVDKADVVRITVPFEIQDGKIVWDYGSL
NIEIYRRSEEEKLAKALEEVEEREKELEERISEIEETATRIKNLVEELLEKIERLKEEHTSLKLKAEE

>tg0941 hypothetical protein TGAM_0941
atgaagctcagcacgggttatgtccgggcctctggctacgcccacaaggtcaggagggttctctttgctctcacgagggg
aaaggtcgatccgaaggaagttgtaagggctgcgggggagctgaaccagtacatctttgagaggtttcaagagcttggag
tggacaaggccgacgtcgtccggataaccgttccctttgagatccaggacggaaagatcgtctgggactacgggagtcta
aacatcgagatctaccggaggagtgaggaggagaaacttgcgaaggcccttgaggaagttgaggagagggaaaaagagct
tgaagagcgtatcagtgagattgaggaaaccgcaacgaggattaagaaccttgttgaggagctcctcgagaagatagaac
gcctaaaggaggaacacacgtcgcttaagctgaaggcggaggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 876591 - 878034 (Additional range around tg0941 is :500nt.)

>Thermococcus gammatolerans EJ3 CAGATCCCCGGAACCTTTGGCGGGTTGTAGGTGATGTGGTAAACTGCCCCACAGTTCGGACATATCCTCCTGCCGGAGAT TCTCTCAACGCTGGTATCCTCATCGATGAATATCTCCAGTGCCAGATCGAGCCTTATCCCGTGGTCGTAGAGGTAGTTCT CAAGGGCTATAACCTGCTCGGGCGTTCTCGGATACCCGTCCAGTATGAAGTTTTCCCTCTGACGCCTCAGGCGGGAGATT ATCAGGGTGTTTACTATCGTGTCGGGGATCAGGTCACCCCTGCTCAAATAGGCCGCCATCTCGAGACCGAGGGAGCTTTT CCTCTCTATCTCTCCTCTTATGAGGTCTCCCGAGGAGATGTACGTGAGGCCGTACTCTTCCACGATCCTTCGGGAGTGGG TGCTCTTTCCCGATCCCGGTGGTCCAAAGATCAGGATGTTCATGGGTAGCCACCAATAAGCATTTATGCACGAAAGTTGA ATAATCTTTTGGTGATGGCC atgaagctcagcacgggttatgtccgggcctctggctacgcccacaaggtcaggagggt tctctttgctctcacgaggggaaaggtcgatccgaaggaagttgtaagggctgcgggggagctgaaccagtacatctttg agaggtttcaagagcttggagtggacaaggccgacgtcgtccggataaccgttccctttgagatccaggacggaaagatc gtctgggactacgggagtctaaacatcgagatctaccggaggagtgaggaggagaaacttgcgaaggcccttgaggaagt tgaggagagggaaaaagagcttgaagagcgtatcagtgagattgaggaaaccgcaacgaggattaagaaccttgttgagg agctcctcgagaagatagaacgcctaaaggaggaacacacgtcgcttaagctgaaggcggaggag TGACTTTCTTCAAA CTTTCGGCTTTCTTACTCTTTTAGAGTTCAATTTTTAAACTAGAGTCCTCATAGGGAGGCCTATCCCCAAATACGCCGTG ATGTTCTTTAAAATTCAACTCCAAGTTTAAAGCCGAGGTATTTTCGGTTTTTCGCCGAAAAGCATTTATATTCAAAAAAT GTACACTGTAGTGCAAAACTTTAATGGAGGTGCAGAGATGAACTCGGCTGTTGTAATCCTGATAGCCGCCGCCATATACG TCAGCATGTACTACACCTACGGTAAAAGCCTGCAAAACAAGGTCGTCAAGGCCGATCCCAACAGGCCAACGCCGGCCCAC AGGCTCTACGACGGCGTTGACTACGTTCCGGCGCACCCGCTTGTTCTCTATGGACACCACTTCGCTTCAATAGCAGGAGC TGGACCAATAGTCGGTCCGGCGGTGGCAATGGCCTGGGGATGGCTTCCGGGACTGCTGTGGGTCTGGTTTGGAAACGTCT TCATT