tg0947

Coordinates:881412-882062

>tg0947 hypothetical protein TGAM_0947
MELTSGLLLAIMVLAAVSSIQFYKGRKLNLQLMQHYLRSIEEVVKPEDKDYVWLGGYIGFRASYKVNRDNLRKFEYTLTL
LPRHSILYFPIALLTSRHDKIYFVIRPFAEIRREAHLIQKGYYRLKPKIENEDFLQRETIEIAGKEYEALFEKRRDVEKL
KELVENLSKPHNVKHVSLTPKTNVFYVFMKPEPDTIEEDVKKLVRFTNERLKESPFS

>tg0947 hypothetical protein TGAM_0947
atggagcttacatccggtttgttgctggcgataatggtgctcgctgcagtctcatcgatccagttctacaaggggagaaa
actgaatctacagctgatgcagcactacctccgctcgattgaggaagttgtgaagcccgaggacaaggactacgtgtggc
tcggcggctacatcggcttcagggcgagctataaggtgaaccgcgacaacctaaggaagttcgaatacacgctaacgctc
ctcccgaggcacagcatcctttacttcccgatagcgctccttacgagcagacacgacaagatttacttcgtaatcaggcc
cttcgccgagattaggcgcgaggcacacctcatccagaagggctactacaggctaaaaccgaaaatcgaaaacgaggact
ttctccagagggagacgattgagatagcgggcaaggagtacgaggccctcttcgaaaagaggagggacgttgaaaagctc
aaggagctcgtcgagaacctttcaaagccccacaacgtcaagcacgtctccctgacgccgaaaaccaacgtcttctacgt
tttcatgaaacccgagcccgacactatagaggaggacgtcaaaaagctcgttcgcttcaccaacgagaggctcaaggaaa
gcccgttctcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 880912 - 882562 (Additional range around tg0947 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTCATAACCGTAGGGCGGGAGATTCCCGAGATAAGAGTAAAGCTTGAGGCGCAGAGGAAGGTGCTCGAGGAAATTCCAA AGAAGTTCCCGAACGTTGAGATAATAAAAATCCCCATGTTCCCGAGGGAGCCGAGGGGCCTGGAGGAGCTTGAGAAACTC GGAGGTATGATACTTGAAGGTGGGAAGGAGGGAGATACTTGAACTCCTGAAAAGCGTCAAGAACCCTTTCACGGACATGG ACATTGTCAGTGAGGGGCTGGTAACGAAGGTTGAGGTGGACGAAGTTGAAAACAAGGTCAGGATATACGTTGCCTTCGCG AGGCACACCCCACCGCATCCGTTCGTAATGGCCGTGAACTGGCCCCTTCAGGCGAAGATAGTTAGGGACATGGTAAAGGT TTTAGAGGACAAGGTGGGATACCTTGAAATACTCGATGACACAACCCTTCAGAGGTACTACCCTCTGAACGACGAGGAAT GATAAAATGGGGGTTGAAGC atggagcttacatccggtttgttgctggcgataatggtgctcgctgcagtctcatcgat ccagttctacaaggggagaaaactgaatctacagctgatgcagcactacctccgctcgattgaggaagttgtgaagcccg aggacaaggactacgtgtggctcggcggctacatcggcttcagggcgagctataaggtgaaccgcgacaacctaaggaag ttcgaatacacgctaacgctcctcccgaggcacagcatcctttacttcccgatagcgctccttacgagcagacacgacaa gatttacttcgtaatcaggcccttcgccgagattaggcgcgaggcacacctcatccagaagggctactacaggctaaaac cgaaaatcgaaaacgaggactttctccagagggagacgattgagatagcgggcaaggagtacgaggccctcttcgaaaag aggagggacgttgaaaagctcaaggagctcgtcgagaacctttcaaagccccacaacgtcaagcacgtctccctgacgcc gaaaaccaacgtcttctacgttttcatgaaacccgagcccgacactatagaggaggacgtcaaaaagctcgttcgcttca ccaacgagaggctcaaggaaagcccgttctcc TGAGTTCTTTTGCCCTTTCTTCGAAAGCTTTATTTCGTTGAACCGCA AGTTATACATGGTGATACCTTTGGTTAGCATACGCCTCAAGGTTGGGCCCAAGGGACAGATAGTAATCCCCAAGGTTTTC CGCGAGGCCTACGGTATAAAGGAGGGCGGGGAAGTGATAGTCGAGCCTACGGAGGAGGGTCTCGTTATTAAAAAGCCGCC GAGCAAAGAGGAACTCCTAAGAAAGCTCAAGGAGTATCACGAGAAGCGAAAAGGCACTAAGCCGGCAAAACTGGGAGAGC TCAAAGGGATAAGCCTCGAAGACGAGTTCGACGAGGTCTGGGGGATTGAGGAATGAAGCTCTTCCTTGATACCAACCTTT TCGTTTACCTTAACTCGAGAATTCCAGAGGATATCGCCAACGAGCTCGATGAATTCTACGCGGACCTTACTCAGAAGCAT GAGCTCTACACGGATGTGCTGGTTCTCGATGAGCTAATCCACGTCTCAAAGC