tg0960

Coordinates:891459-892226

>tg0960 SAM-dependent methyltransferase, putative
MASLYDYMRLPMDPSSEIAQKRYVAIRSFFNWALKEKLVPRKRELRVLDLCAGTGIAGAALLETLTEWGIEASLTLIEKR
KEDLLLVEEWLSGEREVIGIVGDCLTELPKLRDFDVALLWGHSMAHFNPFQAAELFRRVAKALGHDGVFLIEETDNFERL
FYRGRYRSPHVEARGDDWTLVSLDEGYSRKNGTMLVGFYKLPGWEPVERAEIRLWDLAGIAGMVSMAFERVGIVSKNEHG
IVGVDDVVYGAFPHRA

>tg0960 SAM-dependent methyltransferase, putative
atggcttccctctacgattacatgagattgcctatggatccgtccagcgagattgcccagaagaggtacgtggcgataag
gagtttctttaactgggccctcaaagagaaactcgtacccagaaagagggagctcagagttcttgacctgtgcgctggaa
ccgggatagccggggccgctctcttggagaccctcaccgagtggggcatagaggcctcgctgacccttattgaaaaaaga
aaggaggacctcctcctggttgaggaatggctgtcgggtgagagggaagtcattggaatcgtcggggactgcctcacaga
gctcccaaagctgagggacttcgatgttgccctgctttgggggcacagtatggctcacttcaacccgtttcaggcggcgg
aactctttcggagggtcgcgaaagctctgggccatgatggggtgttcctgatagaggaaacagacaacttcgagaggcta
ttctacaggggaaggtatcgcagtccccacgtcgaggcacggggcgatgactggacgctggtctccctcgacgaaggata
ctcacgaaagaacggcactatgctcgttggattttacaaacttcccggctgggagcccgttgagagggccgagatcagac
tctgggacctagcaggaattgcgggaatggtctcgatggcctttgagagggttggtatcgtttcaaagaatgaacacgga
atcgttggggtggacgatgttgtctacggtgccttccctcaccgggcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 890959 - 892726 (Additional range around tg0960 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCAACCAATAAAGAAGGGAACCATCAGGCCGATGGTCATCTCCTTCAAGTACGGGCATGCATACCTCACCCAGACCTCA CACGGTGGCGTCGTCGGTGGGGTCGGCTACGAGCTCGGGCCAACCTACGACCTCAATCCAACCTACGAGTTCCTCCGCGA GGTGAGCTACTACTTCACCAAGATTATCCCCGCTTTGAGGGAGCTCCTAATATTGAGGACGTGGGCCGGCTACTACGCCA AAACTCCCGACAGCAACCCCGCGATAGGGAAAATTGAGGAGCTGAGCGACTACTACATTGCCGCCGGCTTCAGCGGGCAC GGCTTCATGATGGCCCCAGCAGTGGCAGAGATGGTAGCGGACCTGATTACCAAGGGCAAGACCGACCTGCCGGTCGAGTG GTACGACCCGTACCGCTTCGAGCGCGGTGAACTCCGCGGGCAGGCTCTTCAGATGGGTTGAGTTTTTAACCCTTCTTTCC AAATTTACCCGGTGGTTTT atggcttccctctacgattacatgagattgcctatggatccgtccagcgagattgcccag aagaggtacgtggcgataaggagtttctttaactgggccctcaaagagaaactcgtacccagaaagagggagctcagagt tcttgacctgtgcgctggaaccgggatagccggggccgctctcttggagaccctcaccgagtggggcatagaggcctcgc tgacccttattgaaaaaagaaaggaggacctcctcctggttgaggaatggctgtcgggtgagagggaagtcattggaatc gtcggggactgcctcacagagctcccaaagctgagggacttcgatgttgccctgctttgggggcacagtatggctcactt caacccgtttcaggcggcggaactctttcggagggtcgcgaaagctctgggccatgatggggtgttcctgatagaggaaa cagacaacttcgagaggctattctacaggggaaggtatcgcagtccccacgtcgaggcacggggcgatgactggacgctg gtctccctcgacgaaggatactcacgaaagaacggcactatgctcgttggattttacaaacttcccggctgggagcccgt tgagagggccgagatcagactctgggacctagcaggaattgcgggaatggtctcgatggcctttgagagggttggtatcg tttcaaagaatgaacacggaatcgttggggtggacgatgttgtctacggtgccttccctcaccgggcg TAATATTCGGG CCTCCTGTCCCTGAAAACGTCGTTGTAGTCGTTGAGCCTCTTGTTCCGGGCAAGACTCAGGTCTATCTCCGCTATTCCAA CCTCCTCCCCGTCCTCGCTCCCCTCCACCAGGGTCTCGGCCAGAGGCGAATTTATCTGACTTCTACCGATGAACCTGAGG CCCCTTTCCTCACCCACACGATCCGCGGTTATCGTGTAGACCCTGTTCTCAAGGGCCCTTATCGGCATGGCCCTAGGAGC GTAGGGCATAACCAAGTTGGCTGGATGGGCTATTATCTCGGCCCCCTTTAGGGCAAGGGTTCTGGCACTCTCCGGGAAGA ACCAGTCAAAGCATATCATAACCCCCACTCGGACAAAGCCGAGGTTAAAGACCTCAAACCCGAGGTTTCCCGGCTCGAAG AACTCCTTCTCCCGGGCAAAGAGGTGAACTTTTCGGTACCTTCCGATGTAGCCGGTCGGACCGACTATGACTGCGGAGTT GTAAAGCCT