tg1003

Coordinates:954059-954343

>tg1003 DNA-directed RNA polymerase subunit L (rpoL)
MRIEVIKREGNTFEFYLEGEDHTFANLLVETLHEDKHVKFAAYSIDHPILMARKPRFKIVTDGKESPEEALEKAAQRVFD
RARAVLEAWKSAIEG

>tg1003 DNA-directed RNA polymerase subunit L (rpoL)
atgaggattgaggtcatcaagagggaaggtaacaccttcgagttctaccttgaaggggaagaccacacgttcgcgaacct
tctggttgaaacactccacgaggacaagcacgtcaagttcgcggcctactcaatcgaccatccgattctcatggccagaa
agccgcgcttcaagatcgtgaccgacggaaaggagagcccggaggaggcacttgaaaaggccgctcagagggtctttgac
cgggcgagggcggtacttgaggcgtggaaatccgcgattgaggga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 953559 - 954843 (Additional range around tg1003 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGGTGAACGTCCAGGGCACAAAGGAGGAGATACGGGAGGCAATAGCCAAAATCAGGGCCATACACAACAGGGTGAGGGC AAAGCTCTACCCGGACAGGCGCGGCCTCTACCACTACTCCCCCGACGACGTATTCCGAGAGGCGGGAACGAGCGTGTCCC TCCCGATTATACTTAAAACCCTCGAGCTGCTGGGAGAGAGGGCGGAAGTGGATGAGGCCAAAGGCGAACTGGTGACCTCC CTACCCTGGGACGAGATTGTCGAGCTCGTGCGCAGGCTGGGTCTCACGCTGTCGGAGATAGCACTTCAGACGACAAGACA GATCAGGGAAGTCGTCCTTCCGGTCTCGGTAGCGTTCGATATGGATCCCCAGGAAGTTCTGGAGCTTCTCGTTGATCTCG GCTTGGCCGAGTGGAAAGAGGATAAGTTTAAATACGAACTCGTGAAGAACAAGGAGCAGGCTCTGGAGGAGGTATTAAAG CGTCTCAGGGGTGATGCTG atgaggattgaggtcatcaagagggaaggtaacaccttcgagttctaccttgaaggggaa gaccacacgttcgcgaaccttctggttgaaacactccacgaggacaagcacgtcaagttcgcggcctactcaatcgacca tccgattctcatggccagaaagccgcgcttcaagatcgtgaccgacggaaaggagagcccggaggaggcacttgaaaagg ccgctcagagggtctttgaccgggcgagggcggtacttgaggcgtggaaatccgcgattgaggga TAACCTTTTAAAGA GTTTTCCTCTTGTCCTCTTTATGAGGGTAAAGTTAAGCGACAGCCAAAAAAAGTTCATCATACTCATCGTGGCAATAGTA GTCTCCAAGCTCGTGCTGTTGGCTGGTGCTGACTTTGAGATCGAAAAGTTCTGTATGAGGTGGGACGGGGAGCATTTCAT AAAAATAGCGGATGAAGGTTACTATGACATACATGAGCTGGCGTTTGGCCCCCTTTTTCCCGCCACGATAAGGCTTCTTT CCCTATTGGGTATAGAAACGTGGCTTGCGGCGTTCATTATCGTAAACCTGCTGAGCGTAGTCCCGCCCCTCATCGTCTTC AGGAGATGGGGCCTCAAGCCCGCCCTCTTCCTGGCCCTGAACCCTGCCTACGTCCTCTTCACCACCGCACCGTACAGCGA GGCAATGGCACTCTCCCTCGCCCTTTTGGCCTATGATCTCAGGGAGAAGAGACCGGAGTTATCGGGGATTTTCCTCGGGC TTGCTG