tg1004

Coordinates:954336-954968

>tg1004 hypothetical protein TGAM_1004
MRAKRVITIHVRDDREKEEFMKELQRLSLPAFIYVHGKLDSIKVNVQGTKEEIREAIAKIRAIHNRVRAKLYPDRRGLYH
YSPDDVFREAGTSVSLPIILKTLELLGERAEVDEAKGELVTSLPWDEIVELVRRLGLTLSEIALQTTRQIREVVLPVSVA
FDMDPQEVLELLVDLGLAEWKEDKFKYELVKNKEQALEEVLKRLRGDADED

>tg1004 hypothetical protein TGAM_1004
atgagggcaaagcgcgtcatcacgatacacgtgcgcgacgacagggagaaggaggagttcatgaaagaactccagaggct
ctcacttccggcgttcatatacgtccacggcaagctcgactccataaaggtgaacgtccagggcacaaaggaggagatac
gggaggcaatagccaaaatcagggccatacacaacagggtgagggcaaagctctacccggacaggcgcggcctctaccac
tactcccccgacgacgtattccgagaggcgggaacgagcgtgtccctcccgattatacttaaaaccctcgagctgctggg
agagagggcggaagtggatgaggccaaaggcgaactggtgacctccctaccctgggacgagattgtcgagctcgtgcgca
ggctgggtctcacgctgtcggagatagcacttcagacgacaagacagatcagggaagtcgtccttccggtctcggtagcg
ttcgatatggatccccaggaagttctggagcttctcgttgatctcggcttggccgagtggaaagaggataagtttaaata
cgaactcgtgaagaacaaggagcaggctctggaggaggtattaaagcgtctcaggggtgatgctgatgaggat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 953836 - 955468 (Additional range around tg1004 is :500nt.)

>Thermococcus gammatolerans EJ3 TGTTAAAGAGGAGAACGGAAACCTCATCGCAACTCGGGCCGGGAGGGTCAAGATAAACAGGGAGAAAATGGAGATAAGCG TTGAACCGGTGACCGACACGCCACCGCTTCCAGAGGTGGGGGACACTGTCCTAGCTCAGGTTTTGGAGGTAAAACCCCAG GTAGTTATAGTCCAGCTCCTTAGAATCGAGGGGAAGGGGAGCAGGGAGATAGCGACGTCCAAGCTCGCGGGTATACACGT TTCCCAGGTAAAGAACGGCTTCGTTGAGGATATGAGCAGGGAGTTCAAAGTTGGTGATATAGTTCGGGCGAGGGTCATCT CAAACGAGAAGAGCCCGATCCAGCTCACTACCCGGGCCCCCGACCTTGGTGTGGTTTACGCCTTCTGCTCGCGCTGCAGG ACGCCGCTCATACGGCGCGGGGACAAGCTCATATGTCCCAAGTGCGGCAACGTCGAGACGAGAAAGCTTTCAACTCTCTA CCGCAAGATGGTGATCTGA atgagggcaaagcgcgtcatcacgatacacgtgcgcgacgacagggagaaggaggagttc atgaaagaactccagaggctctcacttccggcgttcatatacgtccacggcaagctcgactccataaaggtgaacgtcca gggcacaaaggaggagatacgggaggcaatagccaaaatcagggccatacacaacagggtgagggcaaagctctacccgg acaggcgcggcctctaccactactcccccgacgacgtattccgagaggcgggaacgagcgtgtccctcccgattatactt aaaaccctcgagctgctgggagagagggcggaagtggatgaggccaaaggcgaactggtgacctccctaccctgggacga gattgtcgagctcgtgcgcaggctgggtctcacgctgtcggagatagcacttcagacgacaagacagatcagggaagtcg tccttccggtctcggtagcgttcgatatggatccccaggaagttctggagcttctcgttgatctcggcttggccgagtgg aaagaggataagtttaaatacgaactcgtgaagaacaaggagcaggctctggaggaggtattaaagcgtctcaggggtga tgctgatgaggat TGAGGTCATCAAGAGGGAAGGTAACACCTTCGAGTTCTACCTTGAAGGGGAAGACCACACGTTCGC GAACCTTCTGGTTGAAACACTCCACGAGGACAAGCACGTCAAGTTCGCGGCCTACTCAATCGACCATCCGATTCTCATGG CCAGAAAGCCGCGCTTCAAGATCGTGACCGACGGAAAGGAGAGCCCGGAGGAGGCACTTGAAAAGGCCGCTCAGAGGGTC TTTGACCGGGCGAGGGCGGTACTTGAGGCGTGGAAATCCGCGATTGAGGGATAACCTTTTAAAGAGTTTTCCTCTTGTCC TCTTTATGAGGGTAAAGTTAAGCGACAGCCAAAAAAAGTTCATCATACTCATCGTGGCAATAGTAGTCTCCAAGCTCGTG CTGTTGGCTGGTGCTGACTTTGAGATCGAAAAGTTCTGTATGAGGTGGGACGGGGAGCATTTCATAAAAATAGCGGATGA AGGTTACTATGACATACATGAGCTGGCGTTTGGC