tg1006

Coordinates:955645-956283

>tg1006 hypothetical protein TGAM_1006
MFGSYELKTQFIKVPGTKIHLLEEGEFVRYRRGDVTRTIKKSSGGRIILLPAPAVGYGVGLLMIRLKSPLVVPPGEKVEG
YVSAPVELDVLVGGLSIDRFSLTREKYALYGTIEAGAIARYWVSEFSEKEPESVCVVKLSVVNASTEWKAIDKVVFPIKG
STMYYREGRAYYPLITVKLGNGFPEINNTGMAPEDDLVRVGSVKTLPNFIMRW

>tg1006 hypothetical protein TGAM_1006
atgtttggatcctacgagctgaaaacccagttcataaaggttcccgggacaaagattcacctgcttgaggagggcgagtt
cgtaaggtaccgcaggggtgatgtcacgaggacgatcaaaaaaagctctggtggtagaataatccttctccccgcccccg
ccgtcggttatggggttggtcttctcatgatcaggcttaagagcccactcgtcgtcccccctggagaaaaggtagagggc
tacgtcagtgcccccgttgagctcgacgttcttgtgggggggctctcaatagacaggttctcccttacccgggaaaagta
tgccctctacggcacgatagaggccggcgccatagcccgttactgggtctcggagttttcagaaaaagaacccgaaagcg
tttgtgttgttaagctgagcgtcgtaaacgcttccacagagtggaaggccattgacaaggtggtgtttcccataaaaggc
agcaccatgtactacagggagggaagggcatactatcccctcatcacggtcaaactcggcaacggtttcccagagataaa
caacaccggtatggcacctgaggacgacctcgtaagggttggaagcgtcaagacactccccaattttatcatgaggtgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 955145 - 956783 (Additional range around tg1006 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGAGATGACCCTCGCCCGAACTATATCACCAACTTTGAACTCCCTGCTCATATCCTCAACGAAGCCGTTCTTTACCTGG GAAACGTGTATACCCGCGAGCTTGGACGTCGCTATCTCCCTGCTCCCCTTCCCCTCGATTCTAAGGAGCTGGACTATAAC TACCTGGGGTTTTACCTCCAAAACCTGAGCTAGGACAGTGTCCCCCACCTCTGGAAGCGGTGGCGTGTCGGTCACCGGTT CAACGCTTATCTCCATTTTCTCCCTGTTTATCTTGACCCTCCCGGCCCGAGTTGCGATGAGGTTTCCGTTCTCCTCTTTA ACACCCTCGCCGGGCAGGTACTCCTCGATTACACCCAGATAATCCCCCGGGAGAACAAGCTCTCCTTCTTTGGCCGGTTT TTTAGCCTCCATTCCCCCACCTCCGTTGGAATTCCCCCAAAGATCTTTTAAGTCTTTGCCAGCCCGATAACCTTAAATCG TTCCCTGCCAATTAGAGACC atgtttggatcctacgagctgaaaacccagttcataaaggttcccgggacaaagattca cctgcttgaggagggcgagttcgtaaggtaccgcaggggtgatgtcacgaggacgatcaaaaaaagctctggtggtagaa taatccttctccccgcccccgccgtcggttatggggttggtcttctcatgatcaggcttaagagcccactcgtcgtcccc cctggagaaaaggtagagggctacgtcagtgcccccgttgagctcgacgttcttgtgggggggctctcaatagacaggtt ctcccttacccgggaaaagtatgccctctacggcacgatagaggccggcgccatagcccgttactgggtctcggagtttt cagaaaaagaacccgaaagcgtttgtgttgttaagctgagcgtcgtaaacgcttccacagagtggaaggccattgacaag gtggtgtttcccataaaaggcagcaccatgtactacagggagggaagggcatactatcccctcatcacggtcaaactcgg caacggtttcccagagataaacaacaccggtatggcacctgaggacgacctcgtaagggttggaagcgtcaagacactcc ccaattttatcatgaggtgg TGACCGTGTTTTCGAACCTCAGCAACGCGACCAACATAACGATAAGCCTCGGTCCGACG AAGATAACGATAGGCCTCTGGTCGGTCTTCGAGGCGGCACTGATACTCCTCTTGGGCTTTGTTGTTGCGAGGCTCCTGAG GCACCACATAGTTGAGCTCTCCTCCAGCGTGAAGCACGTGTGGATAATCAACGAGGACACCGCCAAGACCGTCCACAACA TGGTGGTTCTCATAGCTCTCTTCTACGCCCTTAAGGTGCTCGGGTTGCTCGACTACAAGGTTGGCGGGTCCTCTGTCAGC GAGATCCTGAGCGCTCTCGTGGTCTTCTATTCTGTCTACGTTCTGGCCAAGAAGTCCAAGGATTACCTCATCATGCACGC GGCACCCTCCGAGCTTCCAGAGGTTCAGATAAAGGCCAAGATCCTCTACTACACCCTCATAACGATAGCGTTCTTCATAG CCCTCAACATAGCCGGACTCACCGGAAGGCTCACCACGAT